KEGG   Geobacillus sp. JF8: M493_01785Help
Entry
M493_01785        CDS       T02798                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
gjf  Geobacillus sp. JF8
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M493_01785
   00330 Arginine and proline metabolism
    M493_01785
   00340 Histidine metabolism
    M493_01785
   00350 Tyrosine metabolism
    M493_01785
   00360 Phenylalanine metabolism
    M493_01785
   00380 Tryptophan metabolism
    M493_01785
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     M493_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(281414..282889)
Genome map
AA seq 491 aa AA seqDB search
MSHPYVSPKLSMETMISIIRNGLKKPSSPQHIVTIGAGMAGLVAASLLKQAGHRITILEA
SERVGGRIYTLRSNFRDDQYLEAGAMRIPHTHRLTLEYIQKFNLPLHPFINSTPRDIVYF
RGVKARLDKYERHPGLFGFPVAPHERGKTASELLQMAIRPVVQFIAQHPEKHWPIVIEQL
DRYSLDSYLRYNPFGLSLSVGAIDMIKAVLSLEGFPELSFLEMLRELMVLFTPNIRFYEI
AGGNDRLPKAFLPQLKDDILFSHKVQKIVQTENSVTIHATHTKILQPFQTTADRVIVTIP
FSVLQFVDIEPRHSFSENKWKAIRELHYAGSTKTGIQFKTRFWEKEGMFGGKTVSDLPIR
YTQYPSQGIGTAGPGVVLASYTWEDDTIPWDSLSDEERLEYTLKNLAVIHGEQVYREFET
GTSHSWVRYPYSGGAFTMMKPNQVTELSPYIVAPEGRVHFAGEHASTHHGWIQGAIESGI
RVAYEVNNSPA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccatccttatgtttctccaaaactatcaatggaaacgatgatctcgatcattcgc
aacggcttaaagaaaccgtcgtcccctcaacatatcgtcaccatcggcgccggcatggcc
gggcttgtcgcggcgtcactgctgaagcaagccggccatcgcatcaccatcttagaggcg
tccgagcgggtcggcggccgaatttacacgctccgctccaacttccgtgacgaccagtat
ctcgaagccggcgcgatgcgcattccccacacccatcgattgacgctcgaatacatccaa
aaattcaacttgccgctccatccgtttatcaacagcaccccgcgcgacattgtatatttt
cgcggcgtgaaagcgcgccttgacaaatatgagcggcatcccggcctctttggctttccg
gtcgccccgcatgaacggggcaaaaccgcttccgagttattgcagatggccattcgcccg
gtcgttcaattcattgcgcaacacccggaaaaacattggccgatcgtcatcgaacagctc
gaccgctactcgcttgactcgtatttgcgttacaacccgttcggcctgtcgttgtccgtg
ggagccatcgatatgatcaaagctgttctctcattagaaggattccccgaactttcgttt
cttgagatgttgcgtgaactcatggtgctgtttacgccgaatattcgcttttacgaaatt
gccggcggaaacgatcggcttccaaaggcctttttgccgcagctgaaggatgacatcctc
tttagccataaagtgcaaaaaatcgtgcaaaccgaaaacagcgtcaccattcatgcgacc
catacgaaaattctccaaccgtttcaaacgaccgctgatcgggtgatcgtcaccatcccg
ttttccgttttgcagtttgtcgacatcgaaccgcgccattcattttccgaaaacaaatgg
aaagcgattcgcgaactccattatgcgggctcaacgaaaaccggcatccaatttaaaaca
cggttttgggaaaaagaggggatgttcgggggcaaaaccgtctcggatttgccgattcgc
tacacccaatacccgagccaaggcatcggcacggccgggccgggagtggtgctagccagc
tatacgtgggaggacgacacgatcccctgggacagcttaagcgatgaagagcggcttgaa
tatacgttgaaaaacttagccgtcatccacggcgaacaagtgtaccgtgaatttgaaacc
ggaacaagtcatagctgggtgcgctatccgtactccggcggcgccttcacgatgatgaag
cccaatcaggtgacggagctgtcgccgtatatcgtggcccccgaaggaagggtgcatttt
gccggcgagcatgcttccacccaccacggatggattcaaggcgccattgaatccggcatc
cgcgtcgcgtatgaagtgaacaactcgccagcttag

DBGET integrated database retrieval system