KEGG   Geobacillus genomosp. 3: M493_01785Help
Entry
M493_01785        CDS       T02798                                 

Definition
(GenBank) amine oxidase
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
gjf  Geobacillus genomosp. 3
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M493_01785
   00330 Arginine and proline metabolism
    M493_01785
   00340 Histidine metabolism
    M493_01785
   00350 Tyrosine metabolism
    M493_01785
   00360 Phenylalanine metabolism
    M493_01785
   00380 Tryptophan metabolism
    M493_01785
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     M493_01785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(281414..282889)
Genome map
AA seq 491 aa AA seqDB search
MSHPYVSPKLSMETMISIIRNGLKKPSSPQHIVTIGAGMAGLVAASLLKQAGHRITILEA
SERVGGRIYTLRSNFRDDQYLEAGAMRIPHTHRLTLEYIQKFNLPLHPFINSTPRDIVYF
RGVKARLDKYERHPGLFGFPVAPHERGKTASELLQMAIRPVVQFIAQHPEKHWPIVIEQL
DRYSLDSYLRYNPFGLSLSVGAIDMIKAVLSLEGFPELSFLEMLRELMVLFTPNIRFYEI
AGGNDRLPKAFLPQLKDDILFSHKVQKIVQTENSVTIHATHTKILQPFQTTADRVIVTIP
FSVLQFVDIEPRHSFSENKWKAIRELHYAGSTKTGIQFKTRFWEKEGMFGGKTVSDLPIR
YTQYPSQGIGTAGPGVVLASYTWEDDTIPWDSLSDEERLEYTLKNLAVIHGEQVYREFET
GTSHSWVRYPYSGGAFTMMKPNQVTELSPYIVAPEGRVHFAGEHASTHHGWIQGAIESGI
RVAYEVNNSPA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccatccttatgtttctccaaaactatcaatggaaacgatgatctcgatcattcgc
aacggcttaaagaaaccgtcgtcccctcaacatatcgtcaccatcggcgccggcatggcc
gggcttgtcgcggcgtcactgctgaagcaagccggccatcgcatcaccatcttagaggcg
tccgagcgggtcggcggccgaatttacacgctccgctccaacttccgtgacgaccagtat
ctcgaagccggcgcgatgcgcattccccacacccatcgattgacgctcgaatacatccaa
aaattcaacttgccgctccatccgtttatcaacagcaccccgcgcgacattgtatatttt
cgcggcgtgaaagcgcgccttgacaaatatgagcggcatcccggcctctttggctttccg
gtcgccccgcatgaacggggcaaaaccgcttccgagttattgcagatggccattcgcccg
gtcgttcaattcattgcgcaacacccggaaaaacattggccgatcgtcatcgaacagctc
gaccgctactcgcttgactcgtatttgcgttacaacccgttcggcctgtcgttgtccgtg
ggagccatcgatatgatcaaagctgttctctcattagaaggattccccgaactttcgttt
cttgagatgttgcgtgaactcatggtgctgtttacgccgaatattcgcttttacgaaatt
gccggcggaaacgatcggcttccaaaggcctttttgccgcagctgaaggatgacatcctc
tttagccataaagtgcaaaaaatcgtgcaaaccgaaaacagcgtcaccattcatgcgacc
catacgaaaattctccaaccgtttcaaacgaccgctgatcgggtgatcgtcaccatcccg
ttttccgttttgcagtttgtcgacatcgaaccgcgccattcattttccgaaaacaaatgg
aaagcgattcgcgaactccattatgcgggctcaacgaaaaccggcatccaatttaaaaca
cggttttgggaaaaagaggggatgttcgggggcaaaaccgtctcggatttgccgattcgc
tacacccaatacccgagccaaggcatcggcacggccgggccgggagtggtgctagccagc
tatacgtgggaggacgacacgatcccctgggacagcttaagcgatgaagagcggcttgaa
tatacgttgaaaaacttagccgtcatccacggcgaacaagtgtaccgtgaatttgaaacc
ggaacaagtcatagctgggtgcgctatccgtactccggcggcgccttcacgatgatgaag
cccaatcaggtgacggagctgtcgccgtatatcgtggcccccgaaggaagggtgcatttt
gccggcgagcatgcttccacccaccacggatggattcaaggcgccattgaatccggcatc
cgcgtcgcgtatgaagtgaacaactcgccagcttag

DBGET integrated database retrieval system