KEGG   Geobacillus sp. JF8: M493_03460Help
Entry
M493_03460        CDS       T02798                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gjf  Geobacillus sp. JF8
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M493_03460
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     M493_03460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580068..581510
Genome map
AA seq 480 aa AA seqDB search
MSEEQRTVVIIGGGITGLTAAYYLQKAIKEQHLPLACKLVEATHRLGGKVQTVVRDGFVI
ERGPDSFLARKTSAFRLVKEVGLEQEIVHNATGKSYILVNGKLYPIPGGAVMGIPTRIAP
FVATGLFSPAGKLRAALDFVLPPVKTDGDMPLGRFFRRRLGDEVVDNLIEPLLSGIYAGD
IDEMSLMATFPQFFQLEQKYGSLVRGAKRTTPKEQKERKGAFQTLKTGLQSLVEEVEKRL
EPGSVIKGTRVERIARAGSVYQLQLSNGETWEADSVIITTPHHIVPDMFADYPFFAPFRS
VPLTSVATVALAFPEQAIRQDIDGTGFVVSRRSDYTMTACTWTHKKWPHTTPSGKALLRG
YVGRPGDEEIVDQPDDEIVRVVLDDLNKVMKIDGQPEFAVISRWKRAMPQYTVGHRERLA
KIKQHMAAELPGVFLAGSSYEGLGLPDCIDQGEKAVRDVLDYLWQGKPDRPAEALYSGVH
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaacaacggacggttgtgattatcggcggcggcattacgggtcttactgcc
gcctactacttgcaaaaagcgatcaaagaacagcatctaccgctggcatgcaagcttgtt
gaggcgacgcaccggctcggcggaaaagtgcagacagtcgtccgcgacggctttgtcatt
gagcgtggcccggactcgtttctagcacggaaaacgagcgcatttcgacttgtgaaagaa
gtcgggcttgaacaggaaatcgtccataatgcgaccggaaagtcgtacattttagttaac
ggaaagctatatccgattccgggcggggcggtgatgggcatcccgacgcgcattgccccg
tttgtggcgaccgggttgttttcccctgcgggcaagctgcgggcggcgctcgattttgtg
ctgccgccggtgaaaacagacggtgacatgccgcttggccgcttttttcgccgccgttta
ggcgatgaagtggtagacaatttgatcgaaccgttgctgtccggcatttatgccggcgac
atcgacgaaatgagcttaatggcgacattcccgcagttttttcagcttgaacaaaaatat
ggaagcctcgttcgtggtgcaaaacgaacgacgccaaaagagcaaaaggagcgaaaaggg
gcgtttcagacattaaaaacgggtttgcagtcgcttgttgaagaggtggagaaacggctt
gagccgggcagcgtcataaaaggaacgcgcgtggagcggatcgcccgcgccggttcggtg
taccagctgcaattgagcaacggtgaaacatgggaggcagacagtgtgatcatcaccacg
ccacaccatattgtgcctgacatgtttgccgattacccgttttttgccccgttccgatcg
gtgccgctgacgtcggtggcgacggtcgcgcttgcttttccggaacaagcgatccgccaa
gatattgacggcaccgggtttgtcgtctcgcgccgcagcgattatacgatgacggcgtgc
acgtggacgcacaaaaaatggccgcatacgacaccatccggtaaagcgctgctgcgcggc
tatgtcggacgtccaggcgatgaggagatcgtcgatcagccggatgacgagattgtccgc
gttgtattggatgatttaaacaaggtgatgaaaattgacggccagccggagtttgccgtc
atctcccgatggaaacgggcgatgccgcaatatacggtcgggcatcgcgagcggctggcg
aagattaagcaacatatggccgccgagttgcctggggtgtttttggccggcagctcctat
gaaggacttgggttgccggattgcattgatcaaggggagaaggcagtccgtgacgtgctt
gattatttgtggcaagggaaacccgaccggccggcagaagccctgtacagcggtgtccat
tag

DBGET integrated database retrieval system