KEGG   Geobacillus sp. JF8: M493_03685Help
Entry
M493_03685        CDS       T02798                                 

Definition
alpha-amlyase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
gjf  Geobacillus sp. JF8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M493_03685
Enzymes [BR:gjf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     M493_03685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
630914..632449
Genome map
AA seq 511 aa AA seqDB search
MGNRLCALLILPFLLFYAWPVQAAEKEERTWQDEAIYFIMVDRFNNMDPTNDEDVNVNDP
KGYFGGDLKGVTAKLDYIKEMGFTAIWLTPIFENMPGGYHGYWIKDFYRVDPHFGTLDDL
KTLVKEAHKRDMKVILDFVANHVGYNHPWLHDPAKKDWFHPKKEIFDWSNQRQLENGWVY
GLPDLAQENPEVKKYLIDAAKWWIKEADIDGYRLDTVRHVPKSFWQEFAKEVKSVKKDFF
LLGEVWSDDPRDLAEYGKYGIDGFVDYPLYGAVKQSLAKRDASLRPLYDVWEYNKTFYDR
PYLLGTFLDNHDNVRFTKLAIDNRNNPVSRIKVAMTYLFTAPGIPIMYYGTEIAMNGGED
PDNRRLMDFRADPEIIDYLKKIGPLRQQLPSLRRGDFTLLYEKDGMAVWKRQYEDETTVI
AINNTGETQHVHLTNDQLPQNKELRGFLLDDLVRGDDDGYDIILDRETAEVYKLREKTGL
NIPFIAAIVIVYALFLLFLYMVKKRAKRMPE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccggctttgtgcgctgctcatccttccgttccttcttttttatgcctggccg
gtgcaggcggcggagaaagaagaacggacgtggcaagatgaagcgatttacttcattatg
gtcgaccggtttaacaatatggacccgacgaacgacgaagatgtgaatgtgaacgatccg
aaagggtatttcggcggcgatttgaaaggagtgaccgcgaagctcgattacatcaaggag
atgggatttaccgccatttggctgacgccgatttttgaaaacatgccgggcgggtatcac
ggctattggatcaaagatttttatcgcgtcgatccgcatttcggcacgcttgacgacttg
aaaacattggtgaaagaagcgcataagcgcgacatgaaagtcattttggactttgtcgcc
aatcacgtcggttacaatcatccgtggcttcatgacccggcgaaaaaagattggttccat
ccgaaaaaagagattttcgattggagcaatcaacgtcagctcgaaaatggctgggtgtat
gggctgccggatttggcgcaggaaaatccggaggtcaaaaaatatttaatcgatgcggcc
aaatggtggatcaaagaagcggacattgacggctatcgcctcgatacggtgcgccatgtg
ccaaaatcattttggcaagagttcgccaaagaagtgaaatcggtgaaaaaagactttttc
cttcttggtgaagtatggagcgacgacccgcgcgatcttgccgagtacggcaaatacggg
atcgacggtttcgtcgattacccgctgtatggcgcggtgaagcagtcgcttgcgaaacgc
gatgcgtcgctgcgcccgctgtatgacgtctgggaatacaacaaaacgttttacgaccgc
ccgtatttgcttggaacgtttttggataaccatgacaacgtccgctttacgaaactcgcc
attgacaaccgcaacaatccggtttcgcgcattaaagtggcgatgacatatttgttcacc
gccccgggcatcccgatcatgtactacgggacggaaatcgccatgaacggcggcgaagat
ccggacaaccgccgtctgatggatttccgcgccgatccggaaatcatcgattacttgaaa
aaaatcggcccgcttcgccaacagctgccatcattgcggcgcggcgattttacgctcttg
tatgaaaaagacggcatggcggtgtggaaacggcaatacgaagatgaaacaacggtcatc
gccataaacaacacgggtgaaacgcagcacgtccacctcaccaatgaccagctgccgcaa
aacaaagagctgcgcggctttttactggacgatcttgtccgcggcgatgatgacggctac
gacattatattggaccgcgaaacggcggaggtgtacaaactgcgggaaaaaacggggctc
aacatcccgtttatcgccgcgatcgtcattgtttacgcgctctttcttctgtttttatac
atggtgaaaaaacgggcgaaacggatgccagaatag

DBGET integrated database retrieval system