KEGG   Geobacillus sp. JF8: M493_09410Help
Entry
M493_09410        CDS       T02798                                 

Definition
thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gjf  Geobacillus sp. JF8
Brite
Enzymes [BR:gjf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     M493_09410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1747366..1748118)
Genome map
AA seq 250 aa AA seqDB search
MREQYPVLPGAEPFYAEHGPVGVLLVHGFTGTPHSMRPLAQAYAKAGYTVCLPRLKGHGT
HYKEMEQTTFHDWIDSVEEGYEWLKERCGTIFVTGLSMGGTLTLYMAERYSSIRGIVLIN
AAIDIPAIRTGMAAEGEVPRYLDSIGSDLKDPEAKELSYEKTPTASLVQLDGLMELVKSE
LERVACPALIFVSDEDHVVPPENADIIFRGIQSSDKEIVRLENSYHVATLDYDQLFIIER
SLQFFAKHSG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacaatatccggtgcttcccggcgccgagccgttttatgccgaacatgggccg
gtcggggtgttgctcgtacacggattcacgggcacgccccacagcatgcgtccgctcgct
caggcgtatgcgaaggcggggtatacggtttgcctgccgcgcttgaaagggcatggaacg
cattacaaagagatggagcagacgacgttccatgattggattgattcggttgaggaagga
tatgaatggctgaaagaacggtgcgggacgatttttgtcaccgggctgtcgatgggcggg
acgctgacgctttacatggcggaacggtattcgtccatccgcggcatcgtgctcattaac
gcggcgattgacattccggccatccgcaccgggatggcggccgaaggcgaagtgccgcga
tatttggactcaatcggctccgatttgaaagatccggaggcaaaagagttgtcgtacgag
aaaacgccgaccgcttcgctcgtgcagttggatgggctgatggagctggtgaaaagcgag
ctggaacgcgtggcatgcccggcgttgattttcgtctcggacgaggaccatgtcgtgccc
cctgagaacgccgatatcatttttcgcggcattcaatcgtcagacaaagagatcgttcgg
ctcgaaaacagctatcatgtcgcgacgcttgattacgatcaactgttcataatcgagcgg
tcgctccaatttttcgccaagcactcgggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system