KEGG   Geobacillus sp. JF8: M493_09675Help
Entry
M493_09675        CDS       T02798                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
gjf  Geobacillus sp. JF8
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M493_09675
   00051 Fructose and mannose metabolism
    M493_09675
Enzymes [BR:gjf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     M493_09675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1804685..1806022)
Genome map
AA seq 445 aa AA seqDB search
MAYFPNIGTIPYEGPESRNPLAFKFYNPDEKVGGKTMEEHLRFSVAYWHTFTGDGSDPFG
VGNMIRPWDKYSGMDLAKARVEAAFELFEKLNVPFFCFHDVDIAPEGETLSETYKNLDEI
VDMIEEYMKTSKTKLLWNTANLFSHPRFVHGAATSCNADVFAYAAAKVKKGLEIAKRLGA
ENYVFWGGREGYETLLNTDMKLELDNLARFFHMAVDYAKEIGFDGQFLIEPKPKEPTKHQ
YDFDVATALAFLQTYGLKDHFKFNIEANHATLAGHTFEHELRVARIHGMLGSVDANQGDT
LLGWDTDEFPTDLYATTLAMYEILQNGGLGRGGLNFDAKVRRGSFEPEDLFYAHIAGMDS
FAIGLKVAHRLLEDRVFEQFIEERYKSYTEGIGREIVDGTADFKKLEEYALQLGDIRNTS
GRLERLKTLLNQYLLEVSVPSVSRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcatatttcccgaatatcggcactattccatatgaaggaccggagtcgcgcaatccg
ttggcgtttaagttttataatccggatgaaaaagtcggcggcaaaacgatggaggagcat
ttgcgcttttcggtggcgtattggcatacgtttaccggggacgggtcggatccgtttggc
gtcggcaatatgattcgtccgtgggacaaatatagcggcatggacttggccaaggcgcgc
gtggaggcggcgtttgagctgtttgaaaagctgaatgttccatttttctgcttccatgac
gtcgacattgcgccggaaggggaaacgctcagcgagacgtacaaaaacttagatgaaatt
gttgatatgattgaagagtacatgaaaacaagcaaaacgaagctgctgtggaatacggcg
aacttgttcagccatccgcgcttcgttcatggggcggcgacgtcgtgcaacgccgatgtg
ttcgcttatgcggcggcaaaagtgaaaaaaggactcgagatcgccaaacggctcggggcg
gaaaactatgtgttttggggcggtcgggaaggatatgagacgctcttgaatacggatatg
aagctcgaacttgacaacttggcccgtttcttccatatggcggttgattatgcgaaagaa
atcggctttgacggccagtttttgatcgagccgaagccgaaagagccgacgaagcatcaa
tacgattttgatgtcgcaacggcgttggcatttttgcagacgtacgggttgaaagatcat
ttcaaattcaatatcgaagcgaaccatgcgacattggccgggcatacgtttgaacatgag
ctgcgcgtcgcccgcattcatggcatgcttggctcggttgacgccaaccagggcgatacg
ctgcttggctgggatacggatgagttcccgacggatttgtatgcgacgacgttggcgatg
tatgaaattttgcaaaacggcggccttgggcgcggcggcttgaactttgatgcgaaagtg
cggagaggctcgtttgaaccggaagatttgttctacgcccatatcgccgggatggacagc
tttgcgatcgggttgaaagtcgcgcaccgcttgttggaagaccgcgtgtttgaacagttc
atcgaggagcggtacaaaagctatacggaaggcattggccgcgaaatcgtcgacggaacg
gccgatttcaaaaagcttgaagaatatgcgctgcagctcggtgacattcgcaatacgtcc
ggccgtcttgagcgcttgaaaacgctgctcaaccaatatttgttggaagtcagcgtgccg
agcgtatcccgttcgtga

DBGET integrated database retrieval system