KEGG   Geobacillus sp. JF8: M493_09750Help
Entry
M493_09750        CDS       T02798                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
gjf  Geobacillus sp. JF8
Brite
Enzymes [BR:gjf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     M493_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1822892..1824115
Genome map
AA seq 407 aa AA seqDB search
MWNVMRKPVTVGLALSLLLPIGMTATSAESADSYANKPSISALHAPQLDQRYKNSFTIGA
AVEPYQLLNQKDAQMLKRHFNSIVAENVMKPINIQPEEGKFNFEQADKIIQFAKKNGMDI
RFHTLVWHSQVPEWFFLDKEGRPMVNETDPVKREQNKQLLLKRLETHIKTIVERYKNDIK
YWDVVNEVVGDDGKLRNSPWYQIAGVDYIKVAFQTARKYGGNNIKLYINDYNTEVEPKRT
ALYNLVKQLKAEGVPIDGIGHQSHIQIGWPSEAEIEKTINMFADLGLDNQITELDVSMYG
WPPRAYPTYDAIPKQKFLDQAARYDRLFKLYEKLGDKISNVTFWGIADNHTWLDSRADVY
YDVNGNVVVDPNAPYTRVEKGAGKDAPFVFDLNYHVKPAYWAIIDHK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatgtcatgcgtaaaccagtaactgttggattagctctatcgctattgcttcct
atcggaatgaccgccacatctgctgagagtgccgattcttatgcaaacaaacccagcatc
agtgcattgcatgccccacaactggatcaacgctacaaaaactcattcacaattggtgcg
gctgttgaaccatatcagctgctgaaccaaaaagacgcccaaatgctaaaacgccacttc
aatagcattgttgctgaaaatgttatgaaaccgatcaacattcagccagaggaagggaaa
tttaactttgaacaagccgacaagatcatccaattcgccaaaaagaatggcatggatatt
cgcttccatacactcgtttggcatagccaagtgccagaatggttctttctcgacaaagaa
ggcagaccaatggttaatgaaacagaccctgtgaaacgcgagcaaaataagcagctgcta
ttaaaacggctcgagactcatattaaaacgatcgtcgagcggtataaaaacgacattaag
tattgggacgttgtaaatgaagtagttggggacgacggaaagctgcgcaactctccatgg
taccaaattgcgggcgtcgattatattaaagtggcattccaaacagcaagaaaatatggc
ggcaacaacattaaactttacattaatgactacaatacagaagtcgagccaaagcgaacc
gccctttacaacttggtcaaacagctgaaagcggaaggggttccgatcgatggcatcgga
caccagtctcacattcaaatcggttggccctctgaagcggaaatcgaaaaaacgatcaac
atgttcgccgatcttgggttagataaccaaattaccgaactcgatgtaagcatgtacggc
tggccgccgcgagcctacccgacgtatgacgccattccaaagcaaaagtttttggaccaa
gcagcccgttacgatcgtttatttaaactgtatgaaaaactcggcgacaaaatcagcaac
gtcaccttctggggtatcgctgataaccatacgtggcttgacagccgagcggatgtttat
tatgacgttaacggaaatgttgttgtcgacccaaatgctccgtacacaagagtggaaaaa
ggagcagggaaggacgcaccgtttgtatttgacctaaattaccatgtaaaacccgcctat
tgggccattattgatcataaatag

DBGET integrated database retrieval system