KEGG   Geobacillus sp. JF8: M493_11530Help
Entry
M493_11530        CDS       T02798                                 

Definition
glutamate dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
gjf  Geobacillus sp. JF8
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:gjf00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gjf00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gjf00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:gjf00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2162356..2163627)
Genome map
AA seq 423 aa AA seqDB search
MAADKHTEEKGQQYDVLASTQIVIHRALEKLGYPEEVYELLKEPIRVLTVRIPVRMDDGS
VKIFTGYRAQHNDAVGPTKGGVRFHPDVTEREVKALSIWMSLKCGIVDLPYGGGKGGIVC
DPRTMSFRELERLSRGYVRAISQIVGPSKDIPAPDVFTNSQIMAWMMDEYSRIREFDSPG
FITGKPLVLGGSHGRETATAKGVTICIREAAKKRGLSLEGARVVVQGFGNAGSYLAKFMH
DAGAKVVGISDVYGALYDPNGLDIDYLLERRDSFGTVTKLFKNTISNKELLELECDILVP
AAIENQITAENASRIKASIVVEAANGPTTLEATEILTQRGILLVPDVLASAGGVTVSYFE
WVQNNQGYYWTEEEVEQRLEKVMVKAFNNVYDMAQTRRVDMRLAAYMVGVRKMAEACRFR
GWV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgataagcatacggaagagaagggccaacaatacgacgtgctggcgtcgaca
caaattgttatacatagagcgttggaaaagctcggctatccggaagaagtgtatgaactg
ttaaaagagccgatccgcgtgctgaccgtccgcattccggtgcgcatggacgacgggtcg
gtgaaaatttttaccggctaccgggcgcagcataacgatgccgtcggcccgacgaaaggc
ggggtgcgcttccatcctgatgtcaccgagcgtgaggtgaaagcgctgtcgatttggatg
agcctaaaatgcggcatcgtcgatttgccgtatggcggcggcaaaggcggcattgtctgc
gacccgcgcacgatgtcattccgcgagcttgagcgcttaagccgcggttatgtgcgcgcc
atcagccaaatcgtcggaccgtccaaagacattccggcgccggatgtgtttacgaactcg
caaattatggcgtggatgatggatgagtacagccgcatccgcgagttcgattcaccgggc
tttattactggaaagccgcttgtcctcggcggttcgcacggccgggaaacggcgacggcc
aaaggggtgacgatttgcatccgggaggcggcgaaaaaacgcggcctgtcgctcgaaggg
gcgcgtgtcgtcgtccaagggttcggcaacgccggcagttatttggcgaagtttatgcac
gacgccggggcgaaagttgtcggcatttccgatgtatacggcgcgctgtacgacccgaac
gggcttgatatcgactatttgcttgagcggcgcgacagctttggcacggtgacgaagctg
tttaaaaatacgatttcgaacaaagagctgcttgaacttgagtgcgacattttagtgccg
gcggccatcgaaaaccaaattacggccgaaaacgcctcgcgcattaaggcaagcattgtc
gttgaggcggcaaacggcccgacgacgctcgaagcgacggaaattttaacgcaacgcggc
attttgctcgtcccggatgtgctcgcaagcgccggcggcgtaacggtgtcgtactttgaa
tgggtgcaaaacaaccaagggtactattggacggaagaggaagtcgaacagcggcttgaa
aaagtgatggtcaaggcgtttaacaatgtatatgacatggcgcaaacgcgccgcgttgac
atgcgtcttgccgcgtacatggtcggcgtccgcaaaatggcggaagcatgccggttccgc
ggctgggtgtga

DBGET integrated database retrieval system