KEGG   Geobacillus sp. JF8: M493_12200Help
Entry
M493_12200        CDS       T02798                                 

Gene name
nahO
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gjf  Geobacillus sp. JF8
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M493_12200 (nahO)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M493_12200 (nahO)
   00650 Butanoate metabolism
    M493_12200 (nahO)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    M493_12200 (nahO)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M493_12200 (nahO)
   00622 Xylene degradation
    M493_12200 (nahO)
   00621 Dioxin degradation
    M493_12200 (nahO)
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M493_12200 (nahO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2275705..2276613)
Genome map
AA seq 302 aa AA seqDB search
MNRTVKVAILGSGNIGTDLMYKILKKRWVLELSMIAGIDPQSEGLARARAEGVYATAGGI
DAILEDPEIKIVFDATSAKAHLKHAKRLKEAGKVAIDLTPAAVGPYVVPPVNLMEHVDKD
NVNLITCGGQATIPLVYAVSRVANVKYAEMVSTVSSSSAGPGTRQNIDEFTFTTSRGLEV
IGGAEKGKAIIILNPAKPPILMRNTVYIAYEDGDDHQIRHSIGQMIHDVQQYVPGYRLKG
EPIFDRRETPKGRLDVVILLLEVEGAGDFLPVSAGNLDIMTASAKQVGEVIAKRLIEMTS
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaacagtgaaagtagcgattctcggatcaggaaatattggaacggatttaatg
tacaaaatattgaaaaaacgatgggtacttgaactaagcatgattgccggcattgatcct
caatcagaaggattagcacgggcccgagcggagggtgtgtacgctaccgccggaggaatt
gatgccatattggaagatcccgaaatcaaaatcgtttttgatgccacgagcgcgaaagct
catctgaaacatgcgaaacgtttaaaagaagcaggtaaagtggccattgatctgactcca
gcagcggtaggaccatatgtagttccgcctgttaatttaatggaacatgttgataaagat
aatgtcaatttgattacttgcggcggccaagccacaattccgctagtttatgcggtcagt
cgagtggcaaacgtcaaatatgccgaaatggtgtcaaccgtatctagcagttcggctgga
cctggtacgagacagaacattgatgaattcacatttaccacgtcccgtggattggaagtg
atcggaggagcggaaaagggaaaagcgatcattattcttaatccggctaaaccgcctatt
cttatgcgcaatacggtttatatcgcttacgaagatggcgatgaccatcaaattcgccac
tcgattggccaaatgattcatgacgttcagcaatatgtgccggggtatcggctgaaggga
gaacctatttttgacagacgggagactccgaaaggacggttggacgttgtcatcttgctc
ttagaagtggaaggggccggcgatttccttcctgtttcagcaggtaatttagacattatg
accgcttcagcaaaacaagttggtgaagttatcgcaaaacggcttattgaaatgacatcg
acagcgtaa

DBGET integrated database retrieval system