KEGG   Geobacillus genomosp. 3: M493_12200Help
Entry
M493_12200        CDS       T02798                                 

Gene name
nahO
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gjf  Geobacillus genomosp. 3
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M493_12200 (nahO)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M493_12200 (nahO)
   00650 Butanoate metabolism
    M493_12200 (nahO)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    M493_12200 (nahO)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M493_12200 (nahO)
   00622 Xylene degradation
    M493_12200 (nahO)
   00621 Dioxin degradation
    M493_12200 (nahO)
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M493_12200 (nahO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2275705..2276613)
Genome map
AA seq 302 aa AA seqDB search
MNRTVKVAILGSGNIGTDLMYKILKKRWVLELSMIAGIDPQSEGLARARAEGVYATAGGI
DAILEDPEIKIVFDATSAKAHLKHAKRLKEAGKVAIDLTPAAVGPYVVPPVNLMEHVDKD
NVNLITCGGQATIPLVYAVSRVANVKYAEMVSTVSSSSAGPGTRQNIDEFTFTTSRGLEV
IGGAEKGKAIIILNPAKPPILMRNTVYIAYEDGDDHQIRHSIGQMIHDVQQYVPGYRLKG
EPIFDRRETPKGRLDVVILLLEVEGAGDFLPVSAGNLDIMTASAKQVGEVIAKRLIEMTS
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaacagtgaaagtagcgattctcggatcaggaaatattggaacggatttaatg
tacaaaatattgaaaaaacgatgggtacttgaactaagcatgattgccggcattgatcct
caatcagaaggattagcacgggcccgagcggagggtgtgtacgctaccgccggaggaatt
gatgccatattggaagatcccgaaatcaaaatcgtttttgatgccacgagcgcgaaagct
catctgaaacatgcgaaacgtttaaaagaagcaggtaaagtggccattgatctgactcca
gcagcggtaggaccatatgtagttccgcctgttaatttaatggaacatgttgataaagat
aatgtcaatttgattacttgcggcggccaagccacaattccgctagtttatgcggtcagt
cgagtggcaaacgtcaaatatgccgaaatggtgtcaaccgtatctagcagttcggctgga
cctggtacgagacagaacattgatgaattcacatttaccacgtcccgtggattggaagtg
atcggaggagcggaaaagggaaaagcgatcattattcttaatccggctaaaccgcctatt
cttatgcgcaatacggtttatatcgcttacgaagatggcgatgaccatcaaattcgccac
tcgattggccaaatgattcatgacgttcagcaatatgtgccggggtatcggctgaaggga
gaacctatttttgacagacgggagactccgaaaggacggttggacgttgtcatcttgctc
ttagaagtggaaggggccggcgatttccttcctgtttcagcaggtaatttagacattatg
accgcttcagcaaaacaagttggtgaagttatcgcaaaacggcttattgaaatgacatcg
acagcgtaa

DBGET integrated database retrieval system