KEGG   Geobacillus sp. JF8: M493_12200Help
Entry
M493_12200        CDS       T02798                                 

Gene name
nahO
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gjf  Geobacillus sp. JF8
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gjf00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:gjf00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:gjf00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:gjf00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:gjf00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2275705..2276613)
Genome map
AA seq 302 aa AA seqDB search
MNRTVKVAILGSGNIGTDLMYKILKKRWVLELSMIAGIDPQSEGLARARAEGVYATAGGI
DAILEDPEIKIVFDATSAKAHLKHAKRLKEAGKVAIDLTPAAVGPYVVPPVNLMEHVDKD
NVNLITCGGQATIPLVYAVSRVANVKYAEMVSTVSSSSAGPGTRQNIDEFTFTTSRGLEV
IGGAEKGKAIIILNPAKPPILMRNTVYIAYEDGDDHQIRHSIGQMIHDVQQYVPGYRLKG
EPIFDRRETPKGRLDVVILLLEVEGAGDFLPVSAGNLDIMTASAKQVGEVIAKRLIEMTS
TA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaacagtgaaagtagcgattctcggatcaggaaatattggaacggatttaatg
tacaaaatattgaaaaaacgatgggtacttgaactaagcatgattgccggcattgatcct
caatcagaaggattagcacgggcccgagcggagggtgtgtacgctaccgccggaggaatt
gatgccatattggaagatcccgaaatcaaaatcgtttttgatgccacgagcgcgaaagct
catctgaaacatgcgaaacgtttaaaagaagcaggtaaagtggccattgatctgactcca
gcagcggtaggaccatatgtagttccgcctgttaatttaatggaacatgttgataaagat
aatgtcaatttgattacttgcggcggccaagccacaattccgctagtttatgcggtcagt
cgagtggcaaacgtcaaatatgccgaaatggtgtcaaccgtatctagcagttcggctgga
cctggtacgagacagaacattgatgaattcacatttaccacgtcccgtggattggaagtg
atcggaggagcggaaaagggaaaagcgatcattattcttaatccggctaaaccgcctatt
cttatgcgcaatacggtttatatcgcttacgaagatggcgatgaccatcaaattcgccac
tcgattggccaaatgattcatgacgttcagcaatatgtgccggggtatcggctgaaggga
gaacctatttttgacagacgggagactccgaaaggacggttggacgttgtcatcttgctc
ttagaagtggaaggggccggcgatttccttcctgtttcagcaggtaatttagacattatg
accgcttcagcaaaacaagttggtgaagttatcgcaaaacggcttattgaaatgacatcg
acagcgtaa

DBGET integrated database retrieval system