KEGG   Geobacillus genomosp. 3: M493_14075Help
Entry
M493_14075        CDS       T02798                                 

Definition
(GenBank) peptidase M28
Organism
gjf  Geobacillus genomosp. 3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2626038..2627123)
Genome map
AA seq 361 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVDIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAIAIDVLKQLKEVDHPNTVYGVGTVQEEVGLRGARTAAQSIEPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGIGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDANKVNEITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggatgaaacgttgacgatgctgaaagcgctgaccgatgcaaaaggcgtc
cccggcaacgaacgggaagcgcgcgatgtgatgaagacatacatagccccatatgcggat
gaagtgacaaccgacggcctcggcagcttaatcgcgaaaaaagaagggaaatcaggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgat
gacaaagggttcatccgctttcagacgctcggcggctggtggagccaagtaatgctcgcc
cagcgcgtcacgatcgtgacgaaaaaaggggacatcaccggcgtcatcggctcaaagccg
ccgcacattttgccgccggaggcgcgcaaaaaaccggtcgacatcaaagacatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggaatggggcgtccgcccgggcgatatg
atcgtgccgtatttcgaatttacggtactgaacaatgaaaaaatgctcctagcgaaagca
tgggacaaccggattggctgtgccatcgccatcgatgtgctcaagcagttaaaagaggtt
gaccatccgaacaccgtatacggcgtcggaacggtgcaggaggaagtcggcttgcgcggc
gcgcgcacggcggcccagtccatcgagccggatatcgcgtttgctgttgatgtcggcatt
gccggcgacacgccgggcgtctcggaaaaagaagcgatgggcaaactcggtgccggcccg
cacatcgtcttgtacgatgcgacgatggtgtcgcaccgcggcttgcgtgaattcgtcatc
gaagtggcggaggagctgaacattccgtatcattttgacgccatgccaggcggaggcacg
gacgccggggcgattcacttaaccggcattggcgttccgtcgctgacgatcgccatcccg
acgcgctacatccattcccacgccgccattttgcatcgcgacgactatgaaaatacggtc
aagctgcttgtcgaagtcatcaaacggcttgacgccaataaggtgaacgaaattacattt
gaataa

DBGET integrated database retrieval system