KEGG   Geobacillus sp. JF8: M493_17670Help
Entry
M493_17670        CDS       T02798                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
gjf  Geobacillus sp. JF8
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gjf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M493_17670
Enzymes [BR:gjf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M493_17670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3299170..3299793)
Genome map
AA seq 207 aa AA seqDB search
MYVMTQSGWLEVICGSMFSGKSEELIRRIRRAQFARQEVKVFKPTIDNRYSEDAVVSHNG
NSVIAIPVATPAEMFRYISTATDVVAIDEVQFFSDDIIDVVQTLADRGYRVIAAGLDQDF
RGEPFGPVPALMAIAESVTKLQAVCTVCGSPASRTQRLINGVPASYDDPVILVGASEAYE
PRCRHHHEVPGKPKKRHGRPLAEHKGE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgatgacgcagtccggttggctggaggtcatttgcggcagcatgttttctggc
aaatcggaagaactgatccgccgcatccgccgcgcccagtttgccaggcaggaagtgaaa
gtgttcaaaccgacaatcgacaaccgctatagcgaggatgccgtcgtatctcacaacggc
aattcggtgatcgccattccggtcgcaacgcctgcggaaatgtttcgctacatttccacc
gccaccgatgtcgtcgccatcgatgaagtgcagtttttttccgatgacatcatcgacgtc
gtgcaaacgctcgcagaccgcggctaccgcgtcatcgccgccggattggatcaagatttc
cgcggcgaaccgttcggaccggtgccagcgcttatggcgatcgccgaatcggtgacgaaa
ctgcaggcggtatgcacggtatgcggctccccagccagccggacacagcggctcattaac
ggtgtgcctgcctcgtatgatgatccggtcattttggttggcgccagcgaagcgtacgaa
ccgcgttgccgccatcaccatgaagtgccgggcaaaccgaaaaagcggcatggccgcccg
cttgctgaacacaaaggcgaatga

DBGET integrated database retrieval system