KEGG   Geobacillus kaustophilus: GK0039Help
Entry
GK0039            CDS       T00217                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00900  Terpenoid backbone biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GK0039
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GK0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAD74324
UniProt: Q5L3V4
Position
51760..52632
Genome map
AA seq 290 aa AA seqDB search
MRLSIKAPAKINLSLDVLYKRPDGYHEVKMVMTTIDLADRIELVALPEEDAIRIVSQNRF
VPDDCRNLAYQAAKLLKETFSIRQGVAISITKHIPVAAGLAGGSSNAAATLRGLNKLWQL
GLTLDELAELGAKIGSDVAFCVYGGTALATGRGEIITPIPSPPPCWVVLAKPPIGVSTAE
VYRNLELERVSHPDVDAMVRAIERQDYAAICRLVGNVLEEVTLKKYPEVAHIKEQMKRFG
ADAVLMSGSGPTVFGLIEHDSRMQRVYNGLRGFCDQVFAVRMLGERHSLD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggttgtcgataaaagcgccggcgaaaatcaatttgtcactcgacgttctttataag
cgcccggatggttaccatgaagtgaaaatggtgatgacgacgatcgatttggccgatcgc
attgagcttgtcgcgttgccggaggaagatgcgatccgcatcgtttcgcaaaaccgcttt
gtgcccgatgattgccgcaacttggcgtatcaggcggcgaagcttcttaaagagacgttt
tcgatccgccaaggggtggccatttcgattacgaagcatattccggtggccgccggattg
gcgggaggaagcagcaatgcggcggcgacgctgcgcgggttgaacaagctttggcaactc
ggattgacgctcgatgaactggcagagctcggggcgaaaatcggatcagatgtcgctttt
tgcgtctacggcggaaccgccttggcgacggggcgcggggaaatcatcactccgatccct
tcaccgccgccgtgctgggttgtgctggccaagcccccgatcggtgtatcgacggcggaa
gtgtaccgaaacttggaacttgagcgtgtcagccatccagacgtcgatgcgatggtgaga
gcgatcgagcggcaagattatgcggcgatctgccggttggtcggcaatgttcttgaggaa
gtgacgttgaaaaaatatccggaagtcgcgcatattaaagaacaaatgaagcggtttggc
gctgatgcggtgctgatgagcggcagcgggccgaccgtgtttggactgatcgagcacgat
tcgagaatgcagcgggtatacaatgggttgcgcggcttttgtgaccaagtgtttgcggtg
agaatgttaggagaacgacattctcttgattaa

DBGET integrated database retrieval system