KEGG   Geobacillus kaustophilus: GK0071Help
Entry
GK0071            CDS       T00217                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gka  Geobacillus kaustophilus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gka00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84189..84716
Genome map
AA seq 175 aa AA seqDB search
MENIAYLALGSNLGDRVSYLRSAIEALHHHQEIFITSSSSIYETDPVGYVNQGKFLNMVI
EVATTLSPFALLDVTQQIERQLGRKREIRWGPRTLDLDILLYNHENIETEQLTIPHPRMA
ERAFVLIPLFEVNSHVAIPNLSEPLIDIIGRLPDKKGVHVWKRKDGEDVFALFES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacatcgcatatctcgctttaggctccaacctcggagatcgtgtttcctatttg
cgttctgccattgaagcgctccatcatcatcaggaaatttttatcacatcgagctcatcg
atttatgaaaccgatccggtcggctatgtcaaccaaggcaagtttttaaacatggtgatc
gaggtggcgaccacgttgtcgccgtttgccttgcttgacgtgacccagcaaatcgaacga
caacttggaagaaaaagggaaattcgctggggaccacggacgttagaccttgacattttg
ctgtataatcatgaaaatattgaaacagagcagctgacgatcccgcatccgcgcatggcg
gagcgggcgttcgtgctcatcccgttgtttgaagtcaactcccacgtggcaataccgaac
ctttccgagccgttaatcgacatcattggccgactacctgacaaaaaaggagttcatgta
tggaagcggaaagatggggaagacgtattcgcgcttttcgaaagttga

DBGET integrated database retrieval system