KEGG   Geobacillus kaustophilus: GK0149Help
Entry
GK0149            CDS       T00217                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gka01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gka00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
160933..161832
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLATAVDQVVQRGRFPLVLGGDHSIAIGTIAGVAKHYERLGVIW
YDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcatcatcgaacgtctggaacgtcttcat
tacgatattgaagatttgggagatattccgattgggaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcgacg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgttaggcggcgaccatagt
atcgccattggcacgatcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcacggcgacgtcaacaccgaggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcacctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgaa
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagttgctgtagcgctgatggggtcgttgtttggtgaaaaactcatttaa

DBGET integrated database retrieval system