KEGG   Geobacillus kaustophilus: GK0149Help
Entry
GK0149            CDS       T00217                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00220  Arginine biosynthesis
gka00330  Arginine and proline metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01130  Biosynthesis of antibiotics
gka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    GK0149
   00330 Arginine and proline metabolism
    GK0149
Enzymes [BR:gka01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     GK0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAD74434
UniProt: Q5L3P6
Position
160933..161832
Genome map
AA seq 299 aa AA seqDB search
MKPISIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYDIEDLGDIPIGKAERLHEQ
GDSRLRNLKAVAEANEKLATAVDQVVQRGRFPLVLGGDHSIAIGTIAGVAKHYERLGVIW
YDAHGDVNTEETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEG
EKKFIREKGIKIYTMHEVDRLGMTRVMEETITYLKERTDGVHLSLDLDGLDPSDAPGVGT
PVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatttcaattatcggggttccgatggatttagggcagacacgccgcggcgtt
gatatggggccgagcgcaatgcgttatgcaggcatcatcgaacgtctggaacgtcttcat
tacgatattgaagatttgggagatattccgattgggaaagcagagcggttgcacgagcaa
ggagattcacggttgcgcaatttgaaagcggttgcggaggcgaatgagaaactcgcgacg
gcggttgaccaagtcgttcagcgggggcgcttcccacttgtgttaggcggcgaccatagt
atcgccattggcacgatcgccggggtggcgaaacattatgagcggcttggagtgatctgg
tatgacgcgcacggcgacgtcaacaccgaggaaacgtcgccgtctggaaacattcatggc
atgccgctggcggcgagcctcgggtttggccatccggcgctgacgcaaatcggcggatac
agccccaaaatcaagccggaacatgtcgtgttgatcggcgtccgttcccttgatgaaggg
gagaagaagtttattcgcgaaaaaggaatcaaaatttacacgatgcatgaggttgatcgg
ctcggaatgacaagggtgatggaagaaacgatcacctatttaaaagaacgaacggatggc
gttcatttgtcgcttgacttggatggccttgacccaagcgacgcaccgggagtcggaacg
cctgtcattggaggattgacataccgcgaaagccatttggcgatggagatgctggccgaa
gcacaaatcatcacttcagcggaatttgtcgaagtgaacccgatcttggatgagcggaac
aaaacagcatcagttgctgtagcgctgatggggtcgttgtttggtgaaaaactcatttaa

DBGET integrated database retrieval system