KEGG   Geobacillus kaustophilus: GK0363Help
Entry
GK0363            CDS       T00217                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00010  Glycolysis / Gluconeogenesis
gka00030  Pentose phosphate pathway
gka00051  Fructose and mannose metabolism
gka00052  Galactose metabolism
gka00230  Purine metabolism
gka00500  Starch and sucrose metabolism
gka00520  Amino sugar and nucleotide sugar metabolism
gka00521  Streptomycin biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK0363
   00030 Pentose phosphate pathway
    GK0363
   00051 Fructose and mannose metabolism
    GK0363
   00052 Galactose metabolism
    GK0363
   00500 Starch and sucrose metabolism
    GK0363
   00520 Amino sugar and nucleotide sugar metabolism
    GK0363
  Nucleotide metabolism
   00230 Purine metabolism
    GK0363
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GK0363
Enzymes [BR:gka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GK0363
    5.4.2.8  phosphomannomutase
     GK0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: BAD74648
UniProt: Q5L332
Position
403435..404844
Genome map
AA seq 469 aa AA seqDB search
MNTSTTKPFAWPAHVFKEYDIRGRAGEELDESFAYWLGRAFADMMQKEGEKRAVVGHDNR
LSSPGLHRALKDGLLDGGCDVVDIGLSTTPMFYYSLYYTNIPCGMIITASHNPGDENGFK
IAMGKTTIYGERIQALRRAMERLSQEQPRPETARGREETLDLAPAYIKMLKEKIQLGPRK
LKVVVDCGNGTPSIIAPQVLKEWGCDVVPLYCESDPTFPNHHPDPVVPENLTALIEMVRK
EQADLGIAFDGDGDRIGVVDETGAIRWGDQLMVLFWREILKRYPGADAPVEVKCSQALVE
EIERLGGKPFFHRTGHSHVKATLRRRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGRLLR
LLSHDERPLSEWFADVPRYAATPETRVACPEEKKPAAIAAVKNQFAGRYPVVDVDGARIQ
FPEGWGLVRPSNTQPILVLRAEAKTEEALAEIKRQLADCLHALELCIDW
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgtcaacaacgaaaccgttcgcatggccggcacacgtgtttaaagaatacgac
atccgcggacgagccggagaggagctcgatgagtcgttcgcgtattggctcggacgggcc
tttgccgacatgatgcaaaaggaaggcgagaagagggcggttgtcggtcatgacaatcgt
ctatcatcgcctggcttgcatcgggcgctcaaagatgggctgctcgatggcggctgcgat
gtcgtcgatattgggctttcgacgacgccgatgttttactacagcttatactacacgaac
attccatgcggcatgatcatcaccgccagccataacccaggggatgagaacggatttaaa
atcgccatgggaaaaacgacaatttatggcgagcgcatccaagcgttgcggcgggcgatg
gagcggctcagccaggaacagccgcggcctgaaacagcgcgcgggcgcgaggaaacgttg
gaccttgctccggcatatatcaagatgttgaaggagaaaatccaactcggtccgcgcaag
ctgaaggtcgtcgtcgactgcggcaacggcaccccatcgatcattgcgccacaagtgctc
aaagagtggggatgcgatgtcgtcccgctttactgtgaatccgatccaacgtttccgaac
catcatccggacccggtcgtgccggagaacttaacggccttgattgagatggtgcgcaag
gagcaggctgatcttggcatcgcgtttgacggcgacggtgatcggatcggggttgtggat
gaaacgggtgcgatccgttggggcgaccaactgatggtgctgttctggcgcgagattctt
aagcgctatccgggagccgacgcgcccgttgaagtgaaatgttcgcaagcgcttgttgag
gaaattgagcggctcggcgggaaaccgttcttccatcgcaccggccattcgcacgtcaaa
gcgacgttgcgccgtcgtccggagatcccgtttgctggtgaaatgtctggccatttgttc
ttcaatgatgagttttacggctatgacgatgcactgtacgccgctgggcgcctgcttcga
ttactgtcgcacgatgagcgcccgctgtccgagtggtttgccgatgtgccgcggtacgcg
gcgacgccggagacgcgagttgcttgtccggaagagaaaaaaccagctgccattgctgcg
gtgaaaaaccagttcgctggccgctatccggttgttgacgtcgatggcgcccgcatccag
ttcccggaaggctgggggttggtgcggccgtcgaacacgcagccgattctcgtcttacgc
gcagaagcgaagacggaggaagcgctggcggagattaagcggcaactggctgattgtctc
catgctcttgaattgtgcatcgattggtga

DBGET integrated database retrieval system