KEGG   Geobacillus kaustophilus: GK0676Help
Entry
GK0676            CDS       T00217                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00630  Glyoxylate and dicarboxylate metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01200  Carbon metabolism
Module
gka_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GK0676
Enzymes [BR:gka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GK0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: BAD74961
UniProt: Q5L269
Position
693200..694486
Genome map
AA seq 428 aa AA seqDB search
MASFAERVRQLEESWKNEERWKGIVRPYSAEDVIKLRGSLDIEYTLARRGAEKLWKLLHT
EDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSVPHVVK
RINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAGVHFED
QLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAADLITSDIDP
RDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLDEARRFAEAIHE
KFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSMFELAR
GYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVALKGST
EEEQFTAI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatttgctgaacgtgtccggcaattagaagaaagttggaaaaatgaggagcgc
tggaaagggatcgttcgtccgtacagcgctgaggatgtcattaaactgcgcggctcgctt
gacatcgagtatacgctcgctcgacgcggggcggaaaaattatggaagctgcttcataca
gaggattacgtcgcggcccttggcgcgctgaccggaaatcaggcggtgcagcaagtgaaa
gcaggcttgaaggcgatttatttaagcggctggcaagtggcggccgacgccaacctcgcc
ggacagatgtatccggaccaaagcctgtatccgtccaacagcgttccgcatgtcgtcaag
cgaatcaatcaagcgttgcagcgcgcggatcaaattcaatacttagaaggcagcggggac
gtggactactttgtgccgatcgtcgctgacgctgaggcggggttcggaggccaactgaac
gtctttgagctcatgaaggcaatgattgaagccggagcggctggcgtccattttgaagac
cagctgtcatcggagaaaaaatgcggccatttaggcggcaaagtgcttttgccgacgcaa
acggcgattcgcaacttgattgcggcgcggttggccgccgatgtcatgggggttccgacg
gtgctcatcgcacgcaccgacgcgaacgctgctgacttgatcacaagcgacatcgacccg
cgcgatcaagcgtttatcactggagaacggacaccggaaggcttctatcgcacaagagcc
ggtttggatcaagcgatcgcccgcgggcttgcctatgcgccgtatgccgacctcatttgg
tgtgagacgagcgagccgaatttggatgaggcgcgccggtttgccgaagcgatccatgag
aaattccccggcaagctgctggcgtacaactgctcgccgtcgttcaactggaagaaaaaa
ttggacgatgaaacgatcgccaaattccagcaagagctcggcaaaatgggatacaagttc
caatttgtcactttggctggcttccatgcgctcaattacagcatgttcgaactggcgcgc
ggctacaaagaacgcggcatggcggcgtacgccgagctgcagcaagcggaatttgccgcc
gagaagtacggatacacggcgacgcgccatcagcgcgaagtcggcacgggctatttcgac
gaagtcgcccaagtgatctccggcggccaatcgtcaacagtcgctttgaaaggatcgacc
gaagaagaacagtttacagccatctaa

DBGET integrated database retrieval system