KEGG   Geobacillus kaustophilus: GK0731Help
Entry
GK0731            CDS       T00217                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:gka01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gka00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gka00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:gka00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:gka00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:gka00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(759990..761000)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHKFKQKLQIEEVEKPKLGYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEIGEGVKSIQIGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGSY
AEYCKAPANYVARIPKNLDPVQVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKAELAAKLGADITINGLQEDPVAAIREKVGGVQAAISVAVT
KKAFEQAYQSVRRGGCLVIVGLPHDELPIPIFDTVLNGVTIKGSIVGTRKDMQEALDFAA
RGKVRPIVEAVPLEKINEVFERMEKGQINGRVVLTM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttgttcacaaattcaagcaaaaacttcaaattgaagaagtggagaaa
ccaaaactaggatatggcgaagtgcttgtgaaaattgaagcttgtggcgtctgccatacc
gatttgcatgcggctcatggggattggccggtaaaaccgaaacttccacttattcctggt
catgaaggggtaggaattgttgttgagatcggtgagggagtgaaatcaatccaaattggc
gaccgtgttggcattccatggttatactcagcatgcggtgaatgtgaatattgtttaagc
ggtcaagaaacactttgtccacatcaattaaacggtggatactctgtcgatggcagttat
gcagaatattgcaaagccccggccaattatgtcgcacgaattcctaaaaacctcgatccc
gtacaagttgctcctattctttgtgctggggtcacaacgtataaagcattaaaagtttca
aatgccaagcctggcgaatgggtcgctatttatggaatcgggggattgggccatattgct
cttcaatatgccaaggcaatgggattaaatgttgttgctgttgatatcagtgatgaaaag
gcagaacttgcggcaaagttgggtgctgatattacgatcaatggattgcaagaagaccct
gtagcagccattcgtgaaaaagtaggcggagtacaagcggctattagcgttgctgtaacg
aaaaaagcgttcgaacaagcttatcaatccgtgcgacgcggcggctgccttgtcatagtt
ggactgcctcacgatgaactgccgattcctatttttgacactgtattaaatggcgttacg
ataaaaggttcgatcgtcggtacacgaaaagatatgcaagaagctctagatttcgccgca
cgcggaaaagttcgccctattgtggaagcggtaccattagaaaaaattaacgaagtattt
gaacggatggaaaaaggtcaaatcaatggccgcgttgttttaacaatgtaa

DBGET integrated database retrieval system