KEGG   Geobacillus kaustophilus: GK1024Help
Entry
GK1024            CDS       T00217                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gka  Geobacillus kaustophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GK1024
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GK1024
  Amino acid metabolism
   00310 Lysine degradation
    GK1024
Enzymes [BR:gka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GK1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051863..1053131
Genome map
AA seq 422 aa AA seqDB search
MAEIKVPELAESITEGTIAQWLKKPGDYVEKGESICELETDKVNVEIMAEESGVLQQLLA
NEGDTVAVGQAIAIIGEGAAAPTAALQAAPQPADETETVAPADSNEQPAPQPVAVAQAPS
QRPIASPAARKMAREKGIDLTQVPTVDPLGRVRKQDVASFAAQPAAAPQPAPQAAPTSTP
AAVPAAEAGKPVIREKMSRRRQTIAKRLLEVTQTTAMLTTFNEIDMSAVIDLRKRKKDKF
FEEHDVRLGFMSFFVKAAVAALKKYPYVNAEIQGDEILLKKYYDIGVAVSTDEGLVVPVV
RDCDRKNFAEIERDIAELAAKARSNKLSLADLQGGTFTITNGGVFGSLLSTPLLNGPQVG
ILGMHSIKLRPVAVDEERIENRPMMYVALSYDHRIIDGKEAVGFLKTVKDLIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagatcaaagtcccagagttagcagaatccatcacggagggaacgatcgcccaa
tggctgaaaaaaccgggcgactacgtggaaaaaggagaatcaatttgcgagcttgaaacg
gataaagtgaacgtggaaattatggcggaagagtcgggtgttttgcagcagctgctggcc
aatgaaggcgatacggttgcggttggccaagcgatcgccattatcggcgaaggagcggca
gcaccgactgccgctttacaagctgctccgcagccagccgatgaaacggaaacggtcgcg
ccggccgacagcaatgaacagccagcgccgcagccagtcgcggttgcccaggcgccgagc
cagcggccaatcgcctctccggccgcccggaaaatggcgcgtgaaaaagggatcgacttg
acgcaagtgccgaccgttgatccgcttgggcgcgtgcgcaaacaagacgtcgcctcgttt
gccgcacaaccggccgccgccccgcagccggctccgcaagccgcgccgacgtcgacgccg
gccgccgttccagccgctgaggccggcaagccggtcatccgcgaaaaaatgtcgcgccgt
cggcaaacgatcgccaaacggctgcttgaagtgacacaaacgaccgcgatgttgacgacg
ttcaacgaaattgacatgtcggcggtcatcgatctgcgcaagcggaaaaaagataaattt
ttcgaagagcatgacgtccgcctcggctttatgtcatttttcgtcaaagcggctgtcgct
gcgctgaaaaaatatccgtacgtcaacgcggaaattcaaggcgatgaaattttgttgaaa
aaatattatgatatcggcgtcgccgtgtcgacggacgaagggcttgtcgttccggttgtg
cgcgactgcgaccggaaaaacttcgctgaaattgagcgcgacattgccgaattggcagcg
aaagcgcgcagcaacaagttgtcgcttgccgatttgcaaggcggtacgtttacgatcacg
aacggcggtgtgttcggttcgcttctgtcgaccccgcttctcaacgggccgcaagtcggc
attttagggatgcattcgatcaaactgcgtccggtcgccgtcgatgaagagcggatcgaa
aaccgtcccatgatgtacgtcgccttgtcatacgaccaccgcatcatcgatggtaaagag
gccgtagggttcttgaaaacggtgaaagacttgatcgaaaatccggaagatttgctgctt
gaaagttga

DBGET integrated database retrieval system