KEGG   Geobacillus kaustophilus: GK1178Help
Entry
GK1178            CDS       T00217                                 

Definition
ribulose-phosphate 3-epimerase (EC:5.1.3.1)
Orthology
K01783  
ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Pentose phosphate pathway
Pentose and glucuronate interconversions
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:gka01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:gka01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:gka00030]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:gka00040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199651..1200313
Genome map
AA seq 220 aa AA seqDB search
MNMIRIAPSILSADFARLAEEIRSVEEGGADWIHVDIMDGHFVPNLTFGPPVVAAIRPVT
KLPLDVHLMIADPDRYIPAFAKAGADVISVHVEACVHLHRTIHFIKEQGVKAGVVLNPHT
PVEMIRHVIGDVDLVLLMTVNPGFGGQAFIPAVVPKIREVARMASEQNKEVDIEVDGGIN
AETAPLCVEAGANVLVAGSAIYNERDRAAAIRTLREVCAN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatgattcgaattgcgccatcgattttatcagccgatttcgcccgcctggctgag
gagattcgttcggtcgaggaaggcggggcggattggattcacgtcgatatcatggacggg
catttcgtgccgaatttaacgttcgggccgccggtcgtggccgccattcgaccggtgacg
aagctgccgcttgacgtccatttgatgatcgccgacccggaccgatacattccggcgttt
gcgaaagcgggcgcggatgtgatttccgtccatgttgaggcgtgcgtgcatttgcatcgg
acgattcattttatcaaagaacaaggcgtcaaagccggggtggtgctcaatccgcataca
ccggtcgagatgatccgccatgtgatcggtgatgtcgatctcgtcttgttgatgacggtc
aatccagggtttggcggacaggcgttcattccggcggtcgtgccaaaaatccgtgaggtc
gcccggatggccagcgaacaaaataaagaggtcgatattgaggtcgacggcggcatcaat
gcggaaacggcgccgctttgcgtggaagccggggcgaacgtgcttgtcgccggctcggcc
atctacaatgaacgggatcgagccgccgccattcgcacgcttcgcgaagtgtgcgccaac
tag

DBGET integrated database retrieval system