KEGG   Geobacillus kaustophilus: GK1761Help
Entry
GK1761            CDS       T00217                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GK1761
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK1761
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GK1761
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GK1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1793513..1794730)
Genome map
AA seq 405 aa AA seqDB search
MSFSYVSHLYCPKCERTYDVDQIHQLCECGSPLLVAYDLEAMRQKVKRDVLREREANLWR
YHELLPVKHPEHIVSLGEGMTPLVPMPRLGREIGIEALYMKDEGVIPTGTFKARGAAVGI
SKAKELGVKQLAMPTNGNAGAAWSLYAARAGIQATVVMPVEAPELTRKECAIAGAELYFV
NGLISDAGQIVAKAIREYGWYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKAIKELQALGWVDGRMPRLVAVQAEHCAPIVKAWKEKKRESEFWPNAHTVAF
GINVPKALGDFLVLEAVYETNGCAIAISDEAILAQQQMVAKLEGAFICPEGAAAFAAART
LRESGWIRDGEKVVVLNTGTGLKYADLVQVVPPVLEPEDSLPMRE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcagctacgtgtctcatctgtattgtccgaagtgtgaacgtacatacgatgtc
gaccaaatccatcaactttgcgaatgcggttcgccgcttcttgtcgcttacgacttggag
gcgatgcgccaaaaagtcaagagggatgtgctgagggaacgtgaagcgaatttatggcgt
tatcatgagttgctgccggtaaagcatcctgaacatatcgtgtcgctcggcgaagggatg
acgccgcttgtgccgatgccgcgcttaggacgggaaatcggcattgaagcgctctacatg
aaagacgaaggggttattccaacagggacgtttaaagcccgcggcgcggcggttgggatt
tctaaagcaaaggaattgggcgtcaaacagctcgcgatgccgacaaacggcaacgcggga
gcggcgtggtcgctatacgcggcgcgggcgggcattcaggcgacagtcgtcatgccggtt
gaggcgccggaactgacgcgaaaggaatgcgccatcgctggggcggaattgtatttcgtc
aacggcctcattagcgatgccgggcaaatcgtcgccaaagcgatccgcgaatacggctgg
tacgatgcgtcgacgttgaaagaaccgtaccggattgaagggaagaaaacgatggggctg
gagatcgccgaacaattctcgtggcagctcccggatgtcattttgtatccgaccggcggc
ggcgtcgggttgatcggcatttacaaggcgatcaaagaactgcaggcgctcggctgggtg
gacggccgcatgccgcggctggtcgctgtgcaggccgagcattgcgcgccgatcgtcaag
gcgtggaaggagaaaaaacgtgaatcggagttttggccgaacgcccatacagtggcgttt
ggcatcaatgtgccgaaagcgcttggcgactttcttgttcttgaggcggtgtatgagacg
aacggctgcgccattgcgatcagcgatgaggcgattttggcccaacagcagatggtggcg
aaactggaaggggcgttcatttgcccggaaggagcggcggcgtttgcggcggcacgaacg
ttgcgcgagagcggttggattcgtgatggggagaaggtcgtcgtgctcaacacggggacg
ggattgaaatacgccgatttggttcaagtcgtcccaccggtgctcgaaccggaagattcg
cttccgatgcgggaataa

DBGET integrated database retrieval system