KEGG   Geobacillus kaustophilus: GK1825Help
Entry
GK1825            CDS       T00217                                 

Definition
acylglycerol lipase (EC:3.1.1.23)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gka  Geobacillus kaustophilus
Brite
Enzymes [BR:gka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GK1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854451..1855203)
Genome map
AA seq 250 aa AA seqDB search
MSEQYPVLPGAEPFYAENGPVGVLLSHGFTGTPHSMRPLAEAYAKAGYTVCLPRLKGHGT
HYEDMERTTFHDWIASVEEGYEWLKKRCGAIFATGLSMGGTLTLHLAEHHPDIRGIVLVN
AAIDIPAIRAGLAGGGELPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMEQTKAK
LDRIVCPALIFVSDEDHVVPPGNADIIFQGIPSTEKEIVRLRNSYHVATLDYDQPMIIER
SLEFFAKHAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaatatccggtgctcccgggcgccgagccgttttacgccgaaaacgggccg
gtcggggtgctgttgtctcacgggtttaccggcacgccccacagcatgcgcccgctcgct
gaggcgtatgcgaaagccggctacacggtctgcctgccgcgcttaaaagggcacggaacg
cattatgaagatatggagcggacgacgttccacgactggatcgcctcggtcgaagaagga
tatgaatggctgaaaaaacgatgcggagcgattttcgccaccggactttcgatgggcggg
acgctcacgctgcatcttgcggaacatcacccagacatccgcggcatcgtgttggtgaat
gctgctatcgatattccggccatccgcgctggtctagcgggtgggggcgagctgccgagg
tatctcgattcgatcggttcggacttgaaaaatccggatgtgaaagagctggcatacgag
aaaacgccgaccgcttcgcttcttcagctggctaggctgatggaacagacaaaagcgaaa
ctcgatcgcatcgtctgcccggcgttgatttttgtctccgacgaagatcacgtcgtgccg
ccgggaaacgccgacatcatctttcaaggcattccatcgacggagaaagagatcgtccgc
ctccgaaacagctaccatgtggcgacgctcgattacgaccaaccgatgattattgaacgg
tcgctcgaatttttcgccaagcacgccggataa

DBGET integrated database retrieval system