KEGG   Geobacillus kaustophilus: GK1877Help
Entry
GK1877            CDS       T00217                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00010  Glycolysis / Gluconeogenesis
gka00052  Galactose metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
Module
gka_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK1877
   00052 Galactose metabolism
    GK1877
Enzymes [BR:gka01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     GK1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAD76162
UniProt: Q5KYS4
Position
complement(1905459..1906505)
Genome map
AA seq 348 aa AA seqDB search
MNITYEKWSEWNGNDVFLFTLTNDRGMGLSATNYGCIVTDIRVPDRNGKIENVVLGFGRF
EPYLTNAPYFGAVIGRVAGRIRGASFELDGITYQLAKNEHNNHLHGGPNGFHRVLWQAEP
VQRDDAVGVVFSYTSPDGEEGYPGTVHVQVEYWLNNDNEWTITHRARSDKTTLFNLTNHT
YFNLSGNGKRDILDHTLTIQSSRVLELNEELIPTGRVLDVAGTPFDLRQGKTIREAVESG
HPQIALVGGGYDHPFWLDRHHDKEIVLSDPESGRVLTVETDEVGVVVYTSNQLPEGLDLG
GVPSRKYLGICLETQGLPDAIHHPQFPSIVLPADKEQVSMTRYRFSAD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacatacgaaaagtggtccgaatggaatggaaacgacgtgttcttattcacc
ttgacaaacgaccgcggcatgggactgtcggcgacaaactacggatgcatcgtgacggac
atccgcgttcccgaccggaacggcaagatcgaaaatgtcgtgctcgggtttggccggttt
gaaccgtatttgaccaacgccccttactttggcgcggtgatcggccgggtggcggggcgc
attcgtggagcgagcttcgaacttgatggaatcacatatcaactggcgaaaaacgaacac
aacaaccacttgcacggcgggccgaacggattccaccgcgtgctttggcaggccgagccc
gtccagcgcgacgatgcggtcggcgtcgtcttttcgtacacaagcccagacggggaggaa
gggtacccgggaacagttcatgttcaagtggaatattggctgaacaatgacaacgaatgg
acgatcacacaccgggctcgttcggacaaaaccactttgttcaatttgacgaaccatacg
tattttaacctaagcggcaacggcaagcgtgatattttggatcacacgctgaccatccaa
agctcgcgtgtgctggaattgaatgaggagctgattccgacgggccgcgtcttggatgtg
gctggcacgccgtttgatttgcggcaaggaaagacgatccgggaggcggtcgaatcgggg
catccgcaaattgcactcgtcggcgggggttatgaccatccgttttggctcgatcggcat
catgacaaagagattgtgctttccgacccggagagcgggcgggtgctgacggtggagacg
gatgaggtcggcgtggtggtgtatacatcgaaccagctgccggaagggttggatctaggc
ggcgtgccgtcgcggaaatatttaggcatctgcctggaaacgcaagggctgccggatgcg
atccatcatccgcagtttccgtcgatcgtattgccggctgacaaggagcaggtgtcgatg
acaaggtatcgatttagtgctgactaa

DBGET integrated database retrieval system