KEGG   Geobacillus kaustophilus: GK2152Help
Entry
GK2152            CDS       T00217                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gka  Geobacillus kaustophilus
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gka00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:gka00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199686..2201875)
Genome map
AA seq 729 aa AA seqDB search
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGERRFSRLDRAFSPNP
DPSDRTFSLDTLPQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLP
ATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALS
MSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNAD
EHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYS
DQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGI
ELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPN
SELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMN
RHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYY
MPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGN
FGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSE
ALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISM
MWRLKAVQR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcggttacatacaatccgcaaacgaagcagtttcatttgcgggcgggcaaggcaagc
tacgtgatgcagcttttccgctccggctatttggctcatatctattggggaaaagcggtg
cgcgatgttcggggggagcggaggttttcgcggctggatcgcgcgttttcccccaatccc
gacccgtctgaccgcacgttttcgctcgatacgctgccgcaagaatatccagcctatggg
aataccgatttccgtgctccggcgtatcaagtgcagcttgagaacggctcgaccgtgacc
gatttgcgctacaaaacgcaccgcatttacaaagggaagcctagacttaacggactgccg
gcgacatacgtggagcatgaacaggaagcggagacgctcgaaattgtccttggagatgcg
ctgatcggtctagaggtcacgttgcagtatacggcgtatgaaaaatggaacgtcatcacg
cgcgcggcccgttttgaaaacaaaggcggcgagcggttgaaactgctgcgtgcgctcagt
atgagcgttgatttcccaactgctgactatgattggatccatctccccggagcgtggggg
cgcgagcgctggatcgagcgccgcccgcttgtgaccggcgtgcaagcggcggaaagccgc
cgcggcgcgagcagccaccaacaaaacccatttatcgcgctcgtcgccaaaaacgccgat
gaacaccaaggcgaagtatacgggttcagctttgtgtacagcggcaatttcctcgcccaa
gtcgaggtcgaccagtttcacaccgcccgtgtctcgatgggaatcaacccgtttgatttc
acatggctgcttcagccgggtgagtcgttccaaacgccggaagtggtcatggtctactcc
gaccaagggttaaatgggatgtcgcaaacgtaccatgaactgtaccgcacccgcctggcg
cgcggcgcattccgcgaccgcgaacgcccgattttgatcaacaactgggaagcaacgtac
ttcgattttaacgaagaaaaactcgtcaacattgcgaaaacggaagcggaactaggcatc
gaactgtttgtgcttgacgatggctggtttggcaagcgcgatgacgaccgtcgttcgctc
ggcgattggatcgtcaaccggcgcaagcttccgaacggcttagacgggttggcgaaacaa
gtgaacgaactcgggatgcagttcggcttatgggtcgaaccggaaatggtgtcgccaaac
agcgaactgtaccggaaacaccccgactggtgtctgcatgtgcccaaccgcccgcgttcg
gaaggacgaaaccagcttgtgctcgattattcccgcgaagacgtttgcgactatatcatc
gagacgatctcgaacgtcctcgcaagcgcgccgatcacgtacgtgaaatgggacatgaac
cgccatatgacggaaataggctcctccgccctgccgcccgagcgccagcgcgaaacggcg
caccgctatatgcttggactgtaccgcgtcatggacgagatgacctcgcgctttccgcac
attttgtttgaaagctgttcgggaggcggggggcggtttgacccggggatgctgtattat
atgccgcaaacgtggacgagcgacaataccgatgccgtctcgcgcctgaaaattcaatac
ggcacgagcctcgtctatccgattagtgcgatgggcgcccacgtctcggcggtgccgaac
caccaagtcgggcgggtggcgtcgctcaagacgcgcggccatgtcgcgatgtcaggcaac
ttcggctatgagctcgatatcacgaaattgacggaaacagaaaaacaaatgattaagcaa
caagtcgcgttttacaaggacgtacgccgcctcgtccagttcggcacgttttatcgactg
ctaagcccgtttgaaggcaacgaggcggcgtggatgttcgtctctgccgaccgctcggaa
gcgctcgtcgcctacttccgcgttctggccgaagcgaacgcgccgctgtcatacctgcgc
ttaaaagggcttgacccgaatcaagactacgaaatcgagggacttggcgtttacggcggc
gacgagctgatgtatgccggagtggccttgccgtaccgctctggcgattttatcagcatg
atgtggcgattgaaagctgttcaacgataa

DBGET integrated database retrieval system