KEGG   Geobacillus kaustophilus: GK2152Help
Entry
GK2152            CDS       T00217                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gka  Geobacillus kaustophilus
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GK2152
  Lipid metabolism
   00561 Glycerolipid metabolism
    GK2152
   00600 Sphingolipid metabolism
    GK2152
Enzymes [BR:gka01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GK2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199686..2201875)
Genome map
AA seq 729 aa AA seqDB search
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGERRFSRLDRAFSPNP
DPSDRTFSLDTLPQEYPAYGNTDFRAPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLP
ATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALS
MSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNAD
EHQGEVYGFSFVYSGNFLAQVEVDQFHTARVSMGINPFDFTWLLQPGESFQTPEVVMVYS
DQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTEAELGI
ELFVLDDGWFGKRDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGMQFGLWVEPEMVSPN
SELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMN
RHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYY
MPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVASLKTRGHVAMSGN
FGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSE
ALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISM
MWRLKAVQR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcggttacatacaatccgcaaacgaagcagtttcatttgcgggcgggcaaggcaagc
tacgtgatgcagcttttccgctccggctatttggctcatatctattggggaaaagcggtg
cgcgatgttcggggggagcggaggttttcgcggctggatcgcgcgttttcccccaatccc
gacccgtctgaccgcacgttttcgctcgatacgctgccgcaagaatatccagcctatggg
aataccgatttccgtgctccggcgtatcaagtgcagcttgagaacggctcgaccgtgacc
gatttgcgctacaaaacgcaccgcatttacaaagggaagcctagacttaacggactgccg
gcgacatacgtggagcatgaacaggaagcggagacgctcgaaattgtccttggagatgcg
ctgatcggtctagaggtcacgttgcagtatacggcgtatgaaaaatggaacgtcatcacg
cgcgcggcccgttttgaaaacaaaggcggcgagcggttgaaactgctgcgtgcgctcagt
atgagcgttgatttcccaactgctgactatgattggatccatctccccggagcgtggggg
cgcgagcgctggatcgagcgccgcccgcttgtgaccggcgtgcaagcggcggaaagccgc
cgcggcgcgagcagccaccaacaaaacccatttatcgcgctcgtcgccaaaaacgccgat
gaacaccaaggcgaagtatacgggttcagctttgtgtacagcggcaatttcctcgcccaa
gtcgaggtcgaccagtttcacaccgcccgtgtctcgatgggaatcaacccgtttgatttc
acatggctgcttcagccgggtgagtcgttccaaacgccggaagtggtcatggtctactcc
gaccaagggttaaatgggatgtcgcaaacgtaccatgaactgtaccgcacccgcctggcg
cgcggcgcattccgcgaccgcgaacgcccgattttgatcaacaactgggaagcaacgtac
ttcgattttaacgaagaaaaactcgtcaacattgcgaaaacggaagcggaactaggcatc
gaactgtttgtgcttgacgatggctggtttggcaagcgcgatgacgaccgtcgttcgctc
ggcgattggatcgtcaaccggcgcaagcttccgaacggcttagacgggttggcgaaacaa
gtgaacgaactcgggatgcagttcggcttatgggtcgaaccggaaatggtgtcgccaaac
agcgaactgtaccggaaacaccccgactggtgtctgcatgtgcccaaccgcccgcgttcg
gaaggacgaaaccagcttgtgctcgattattcccgcgaagacgtttgcgactatatcatc
gagacgatctcgaacgtcctcgcaagcgcgccgatcacgtacgtgaaatgggacatgaac
cgccatatgacggaaataggctcctccgccctgccgcccgagcgccagcgcgaaacggcg
caccgctatatgcttggactgtaccgcgtcatggacgagatgacctcgcgctttccgcac
attttgtttgaaagctgttcgggaggcggggggcggtttgacccggggatgctgtattat
atgccgcaaacgtggacgagcgacaataccgatgccgtctcgcgcctgaaaattcaatac
ggcacgagcctcgtctatccgattagtgcgatgggcgcccacgtctcggcggtgccgaac
caccaagtcgggcgggtggcgtcgctcaagacgcgcggccatgtcgcgatgtcaggcaac
ttcggctatgagctcgatatcacgaaattgacggaaacagaaaaacaaatgattaagcaa
caagtcgcgttttacaaggacgtacgccgcctcgtccagttcggcacgttttatcgactg
ctaagcccgtttgaaggcaacgaggcggcgtggatgttcgtctctgccgaccgctcggaa
gcgctcgtcgcctacttccgcgttctggccgaagcgaacgcgccgctgtcatacctgcgc
ttaaaagggcttgacccgaatcaagactacgaaatcgagggacttggcgtttacggcggc
gacgagctgatgtatgccggagtggccttgccgtaccgctctggcgattttatcagcatg
atgtggcgattgaaagctgttcaacgataa

DBGET integrated database retrieval system