KEGG   Geobacillus kaustophilus: GK2199Help
Entry
GK2199            CDS       T00217                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthasealpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00260  Glycine, serine and threonine metabolism
gka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01130  Biosynthesis of antibiotics
gka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK2199 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GK2199 (trpA)
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GK2199 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA ThiG PcrB DUF2178
Motif
Other DBs
NCBI-ProteinID: BAD76484
UniProt: Q5KXV2
Position
complement(2241549..2242355)
Genome map
AA seq 268 aa AA seqDB search
MPLSVNPPLFIPFIVAGDPAPDVTIDLALALEEAGADILELGVPYSDPLADGPTIQRAAA
RALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLGEESFFALARENGADGVLIP
DLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAAQGFLYCVSSLGVTGVRETLP
ETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDGVVVGSALVQKVEQLAPRLQTP
DEREAAVAEFAAYARSLAAPLREAYSSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgccactgtccgttaatccgccgctatttatcccgtttatcgttgccggtgatccggct
cccgatgtgacgatcgatctcgccttggcgcttgaggaggccggcgctgacatattggag
cttggcgtgccgtactccgacccgctcgctgacggaccgacgattcaacgcgccgccgca
agggcgcttgacgggggcatgacgctgccgaaagccattcagcttattggcgagatgcga
aaaaaaggggtaaacattccgattattctctttacgtattacaatcctgtgttacaatta
ggagaagaatccttttttgctttagcgcgggaaaatggagccgacggcgtgctcattccc
gatttgccgtttgaggaaagcggtccgctccgcgaacttggcgaacggtttggtctcccg
ctcatttcgcttgttgcgccgacgtcgaagcagcggatcgagcggatcgcttcggcggcg
caagggtttttgtattgcgtctcctcgctaggcgttacaggcgtgcgtgagacgctgccg
gagacgctcggcgatttcctccgcgaagtgaagcggcatagccgcgtcccggtcgccgtc
ggctttggcatttcggcgccggagcaagtcgcgatgttgaaagaggtgtgcgacggcgtt
gtcgtcggcagcgcgctcgtgcaaaaagtcgagcagctggctccgaggttgcagacgccg
gacgaaagggaagcggccgtcgccgagtttgctgcctacgcccgttcgcttgccgcgccg
cttcgagaagcctattcttcgcgctaa

DBGET integrated database retrieval system