KEGG   Geobacillus kaustophilus: GK2200Help
Entry
GK2200            CDS       T00217                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthasebeta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GK2200 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK2200 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GK2200 (trpB)
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GK2200 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2242339..2243556)
Genome map
AA seq 405 aa AA seqDB search
MMERVPNEYGRFGDFGGKFVPETLMLPLEEIEAELDKALADESFKQEYIRILQHYSGRPT
PLTFAPNLTRQVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHG
VAAATVAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPVSSGNRTLKDATNEAIRY
WVAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAREGKLPDVIVACVGGGSN
AIGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATITKGTKGVIHGAMTYLLQDEYGQILEP
YSISAGLDYPGVGPEHAYLASIGRVRYESATDAEAVAAFQLLAQTEGIIPAIESAHAVAK
AVELAREMPPDETVLICLSGRGDKDVQTMMRHLGAREGEDIATVR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacgcgttccgaatgaatacggccggtttggcgatttcggcggcaagtttgtc
cctgagacgctcatgcttccgcttgaggaaatcgaagcggagcttgacaaagcgcttgct
gatgaatcgttcaaacaagaatacatccgcattttgcagcattactccggtcgcccgacc
ccgctcacgttcgcgccgaatttgacacggcaagtcggcggcgcgaaaatttatttaaag
cgcgaagatttaaaccatacgggcgcccataaaatcaacaacgcgatcggccaggcgctt
ttggcaaaacggatgggcaagaaaaagctgatcgctgaaaccggagccggccagcacggc
gtcgccgcggcgacggtggccgcccatttcggcatggattgcatcgtttttatgggcgaa
gaagacatcaagcggcaggagctgaacgtgtttcgcatgaagctgttgggcgccgaagtc
gtgccggtgtcaagcggcaaccgaacgttgaaagatgcgacgaacgaagcaattcgctat
tgggtcgcccactgcgacgaccatttttacatgatcggctcggtcgtcggtccgcatccg
tacccgaaaatggtgcgcgagtttcagcgcgtgattggcgatgaagcgaaagaacagttt
ctcgcccgtgaagggaagctgccggatgtcatcgttgcctgcgtcggcggcggcagcaac
gccatcggcatgttttacccgtttttgcaagatgacgtccgcctcgtcggcgtcgaggcg
gccggcaaagggatcgacactccgcaccatgcggcgacaatcacaaaagggacgaaaggg
gtcatacacggggcgatgacctacctgttgcaagacgagtacggacaaattctcgaaccg
tattcgatctcagccggccttgattaccccggcgtcggcccggaacatgcgtatttggcg
agcattggccgcgtccgctacgaaagcgcgaccgatgccgaggccgtcgctgcgtttcaa
ttgttggcgcaaacggaaggcatcattccggccatcgagtcggcccatgcggtggcgaaa
gccgtcgagctcgcccgcgagatgccgccggatgaaacggtgctcatttgcctgtccggc
cgcggagataaagatgtgcaaacgatgatgcgccatcttggtgcgagggaaggtgaagac
attgccactgtccgttaa

DBGET integrated database retrieval system