KEGG   Geobacillus kaustophilus: GK2200Help
Entry
GK2200            CDS       T00217                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthasebeta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00260  Glycine, serine and threonine metabolism
gka00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01130  Biosynthesis of antibiotics
gka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK2200 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GK2200 (trpB)
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GK2200 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: BAD76485
UniProt: Q5KXV1
Position
complement(2242339..2243556)
Genome map
AA seq 405 aa AA seqDB search
MMERVPNEYGRFGDFGGKFVPETLMLPLEEIEAELDKALADESFKQEYIRILQHYSGRPT
PLTFAPNLTRQVGGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKLIAETGAGQHG
VAAATVAAHFGMDCIVFMGEEDIKRQELNVFRMKLLGAEVVPVSSGNRTLKDATNEAIRY
WVAHCDDHFYMIGSVVGPHPYPKMVREFQRVIGDEAKEQFLAREGKLPDVIVACVGGGSN
AIGMFYPFLQDDVRLVGVEAAGKGIDTPHHAATITKGTKGVIHGAMTYLLQDEYGQILEP
YSISAGLDYPGVGPEHAYLASIGRVRYESATDAEAVAAFQLLAQTEGIIPAIESAHAVAK
AVELAREMPPDETVLICLSGRGDKDVQTMMRHLGAREGEDIATVR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacgcgttccgaatgaatacggccggtttggcgatttcggcggcaagtttgtc
cctgagacgctcatgcttccgcttgaggaaatcgaagcggagcttgacaaagcgcttgct
gatgaatcgttcaaacaagaatacatccgcattttgcagcattactccggtcgcccgacc
ccgctcacgttcgcgccgaatttgacacggcaagtcggcggcgcgaaaatttatttaaag
cgcgaagatttaaaccatacgggcgcccataaaatcaacaacgcgatcggccaggcgctt
ttggcaaaacggatgggcaagaaaaagctgatcgctgaaaccggagccggccagcacggc
gtcgccgcggcgacggtggccgcccatttcggcatggattgcatcgtttttatgggcgaa
gaagacatcaagcggcaggagctgaacgtgtttcgcatgaagctgttgggcgccgaagtc
gtgccggtgtcaagcggcaaccgaacgttgaaagatgcgacgaacgaagcaattcgctat
tgggtcgcccactgcgacgaccatttttacatgatcggctcggtcgtcggtccgcatccg
tacccgaaaatggtgcgcgagtttcagcgcgtgattggcgatgaagcgaaagaacagttt
ctcgcccgtgaagggaagctgccggatgtcatcgttgcctgcgtcggcggcggcagcaac
gccatcggcatgttttacccgtttttgcaagatgacgtccgcctcgtcggcgtcgaggcg
gccggcaaagggatcgacactccgcaccatgcggcgacaatcacaaaagggacgaaaggg
gtcatacacggggcgatgacctacctgttgcaagacgagtacggacaaattctcgaaccg
tattcgatctcagccggccttgattaccccggcgtcggcccggaacatgcgtatttggcg
agcattggccgcgtccgctacgaaagcgcgaccgatgccgaggccgtcgctgcgtttcaa
ttgttggcgcaaacggaaggcatcattccggccatcgagtcggcccatgcggtggcgaaa
gccgtcgagctcgcccgcgagatgccgccggatgaaacggtgctcatttgcctgtccggc
cgcggagataaagatgtgcaaacgatgatgcgccatcttggtgcgagggaaggtgaagac
attgccactgtccgttaa

DBGET integrated database retrieval system