KEGG   Geobacillus kaustophilus: GK2442Help
Entry
GK2442            CDS       T00217                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GK2442 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK2442 (glcK)
   00052 Galactose metabolism
    GK2442 (glcK)
   00500 Starch and sucrose metabolism
    GK2442 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    GK2442 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GK2442 (glcK)
   00524 Butirosin and neomycin biosynthesis
    GK2442 (glcK)
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GK2442 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2468749..2469702)
Genome map
AA seq 317 aa AA seqDB search
MEPWLVGIDLGGTTIKMAFVTTEGDIVHKWEIPTNTANRGEHIVADIARSLEKTLAQLGG
AKERLLAAGIGAPGPVEEETGMLYETVNIGWTNYPLKQRLEEATGLPVSVDNDANLAALG
EMWKGAGGGARHLLFVTLGTGVGGGVIANGAIVRGINGAGGEIGHMTMIPDGGARCNCGK
TGCLETIASATGIVRIAKEKLTADERPSELRNGDVTAKAVFDAAKAGDALALEVVDEATY
YLGWALANAANVTNPEKIVIGGGVSKAGDMLVERVAAHFRRFAFPRVAAGAKLVLATLGN
DAGVIGAAWLAKELVGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaccatggttggtaggcattgacctcgggggcacgacaatcaaaatggcgtttgtc
accaccgagggtgacatcgtgcacaaatgggaaattccgacgaacaccgccaatcgcggt
gagcatatcgtcgctgacattgcccgatcgcttgaaaagacgctcgcccagctcggcgga
gcgaaagagaggctgcttgccgccggcatcggcgcccccggaccggtcgaagaggaaacc
ggcatgttgtatgagacggtcaatatagggtggacgaattatccattgaagcaacggctg
gaagaggcgacggggctgcccgtttcggtcgataatgacgccaatctcgccgcgcttggc
gaaatgtggaaaggagcagggggaggagcgcgccatttgttgtttgtgacgcttggcacc
ggcgttggcggcggtgtgattgccaacggagccattgtgcgcggcataaacggcgccggc
ggagagatcggacatatgacgatgatccctgatggcggcgcccgttgcaactgcggcaaa
accggatgtttggaaacgattgcgtccgccaccggcatcgtgcggatcgccaaggagaaa
ttgaccgcagatgagcgtccgagtgagcttcgcaacggggatgtgacggccaaagcggtg
tttgacgccgccaaagcgggcgatgcgctggcattggaagtggtcgatgaagcaacgtac
tatcttggttgggcgttggcgaatgccgccaatgtgacgaacccggagaaaatcgtgatc
ggcggcggcgtgtccaaggcgggtgacatgcttgtcgagcgcgtggccgcccatttccgc
cgcttcgcgttcccgcgcgtcgccgctggggcgaagcttgttttagcgacgcttggcaac
gatgccggcgtcatcggcgccgcctggctggcgaaagagcttgtcggcgcgtaa

DBGET integrated database retrieval system