KEGG   Geobacillus kaustophilus: GK2561Help
Entry
GK2561            CDS       T00217                                 

Definition
ATP-dependent exonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gka  Geobacillus kaustophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gka00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GK2561
Enzymes [BR:gka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GK2561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2572144..2574504)
Genome map
AA seq 786 aa AA seqDB search
MQEQQILALDGRTFIKGVCLAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLN
EGDVYIFYGQFRQHPRFGRQYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVET
LGENAIAAILRDPRALERVPKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKI
YQAYGEEAVDIIHENPYQLVEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQAC
LQEGHVYLREEELMERIGELLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLY
FAEKGIVSNIKRLLGQTPPSAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFI
LTGGPGTGKTTVIKGIVELFAALNGLSLDPADYKQGEPFPVLLAAPTGRAAKRMSEATGL
PAATIHRLLGWNGAEGFSRDENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVG
DEDQLPSVGPGQVLKDLLSSGVIPFARLTEVYRQAEGSSIIELAHEMKRGVVPDDLTAPK
ADRSFIRCRAGQVVDVVRQIADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNP
PAEGKRELSVGEVVYRVGDKVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSF
DGIEVTYTRQDLGQITHAYCCSVHKAQGSEFPIVILPVVKSYYRMLKRNLLYTAVTRSKQ
FLVLCGEEEAFRFGVAKQSDGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDF
MGDEPS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagagcaacaaatcctcgcccttgacggacgcacgttcattaaaggagtgtgcttg
gcggtcatttttcataatgaggaaacattgtacacggtcgtccgcgtgcgcgttgaggaa
acgaacgaagcgcccgttgaggaggaagtcgtcgtcaccggctattttccgcgtttaaac
gaaggggacgtctacatcttttacggacaattccgccaacatccgcgttttggccgccaa
tatgcggctagtcagttccgcaaacagcttccgaacacgaaagaaggagtcattcattat
ttatcgagcggtttgtttaaaggaatcggcaaaaaaacggctgcggcgattgtcgagacg
ctcggcgaaaacgcgatcgccgcgattttgcgcgaccccagggcgctagagcgtgtgccg
aagctgacgaaaaaaaaggcgaagcagctgtacgatgcgcttcgcgcccacgaagggctt
gagcaaacgatgatcgccctcgcccagctcggttttggcccgcagctggccatgaaaatt
taccaagcgtatggcgaagaagcggttgacatcatccacgagaacccgtaccagctcgtt
gaggatatcgaagggatcggctttggccgcgctgatgaaatcgggcgccagctcggcatt
tccggcagccatccggcccggctgcgcgccgcctcgttgtttgttcttgaacaggcgtgc
ttgcaggaagggcacgtttatttgcgcgaggaagagctgatggagcgcatcggggagctg
cttgacggaaggctgagcggtgcggtggatggacgagcgatcagccaaacgcttctgatg
ttaagcgaagaagggaagctgatcgccgagcaagggcgttattatctcccttccctttac
ttcgccgagaaagggatcgtctccaacattaagcggctgctcgggcagacgccgccgtcg
gcgtttgccgagtcggagtttttgctggcgcttggggcgcttgaggaacggcttggcatg
caatatgccccccagcaaagggaagcgatccaacaagcgctttcttcgccgctgtttatt
ttgaccggcggtccgggaacggggaaaacgacggtcatcaaaggcatcgtcgagctgttt
gccgccctaaacggcctgtctcttgacccggctgactacaaacaaggcgagccgtttccg
gtgctgctggccgcaccgaccggccgagcggcgaagcggatgagcgaggcgaccgggctg
ccggcggcgacgatccaccgcttgctcggctggaatggggcggaagggttcagccgcgac
gagaacgaaccgatttccggcaagctgcttgtcatcgatgagatgtcgatggtcgacacg
tggctcgccaaccagctgttaaaagccgtgccaaacggcatgcaagtcatttttgtcggc
gatgaggatcaattgccatccgtcgggccagggcaagtgctgaaagacttgctctcttca
ggcgtcattccgttcgctcggttgaccgaggtgtatcgccaggcggaaggatcatcgatc
atcgagcttgctcatgagatgaagcgcggcgtcgtgccggacgatttgaccgctccgaag
gcagaccgttcattcatccgctgccgtgcgggccaggtcgtcgatgtcgtgcggcaaatc
gcggacaacgcgcgcaaaaaagggttttccgtcaaagatattcaagtgctcgccccgatg
taccgtggtccagcgggcattgaccaattgaacaaagcgcttcaagagctgttcaacccg
ccggctgaggggaagcgggagctgtcggtcggtgaggtcgtctaccgcgtcggcgataag
gtgctgcagctcgtcaatcaaccggaagacaatgtgtttaacggcgacatcggcgaaatc
gttgccattttttacgccaaagaaaatatcgaaaagcaagacttgctcgtcgtctcgttt
gatggcattgaagtgacgtacacacggcaagatttaggacaaatcacccatgcgtactgc
tgttcggttcataaggcgcaaggaagcgagtttccaatcgtcattttgcccgtcgtcaaa
agctattaccggatgttgaaacggaatttgttgtatactgcggtgacaagaagcaagcag
tttctcgttttatgcggggaagaggaagcgtttcgattcggcgtcgcaaaacaaagcgac
ggagcgcgccagacggcgctcgctgagaagctggcgggggcggcggcgccgtttgtcgag
gtcgaactgccgtttgaagaggcgaacatggggatggaaaacgttacgccgtatgacttt
atgggcgatgagccaagctaa

DBGET integrated database retrieval system