KEGG   Geobacillus kaustophilus: GK2592Help
Entry
GK2592            CDS       T00217                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gka  Geobacillus kaustophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gka00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GK2592 (ruvA)
Enzymes [BR:gka01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GK2592 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2607848..2608432)
Genome map
AA seq 194 aa AA seqDB search
MIEFIRGYVDYVCPEYIVIDHNGIGYEIFTPNPFAFQESREAAVTVYTYEYVREGVHALY
GFPTREERNLFAKLLQVSGIGPKGGLAILAAGRPDELARAIEEENEAFLCKFPGVGKKTA
RQMILDLKGKLGALAAPAAARSAAPLSGALAEAVAALKALGYAEREIEKIIPALREEAMS
TEQYVKRALALLLG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagtttatccgtgggtatgtcgattacgtctgcccggaatatatcgtcatcgac
cataacggcatcggctacgagatctttacgccgaacccgtttgcgtttcaggaaagccgc
gaggcggcggtgaccgtctatacatacgaatatgtacgcgaaggtgtgcacgccttgtac
gggttcccaacgcgcgaggagcgcaacttgttcgccaagctgctgcaagtgtcgggcatc
gggccgaaaggcggcctcgccattttggcggccgggcgtccggatgaactggcgcgggcc
atcgaggaagaaaacgaggcgtttttatgcaagtttccaggcgtgggcaaaaagacggcc
cggcaaatgattttggatttaaaagggaagctcggggcgcttgcggcgccggcggctgca
cgttcggccgcaccgctttccggtgcgctcgccgaggcggtggcggcgctcaaggcgctc
ggctacgctgaacgggagatcgagaaaatcattccggcgctccgcgaagaagcgatgtcg
acggaacagtatgtgaagcgggcgctggcgctgcttttgggataa

DBGET integrated database retrieval system