KEGG   Geobacillus kaustophilus: GK2592Help
Entry
GK2592            CDS       T00217                                 

Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gka  Geobacillus kaustophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gka00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GK2592
Enzymes [BR:gka01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GK2592
DNA repair and recombination proteins [BR:gka03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GK2592
    RecFOR pathway proteins
     GK2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2607848..2608432)
Genome map
AA seq 194 aa AA seqDB search
MIEFIRGYVDYVCPEYIVIDHNGIGYEIFTPNPFAFQESREAAVTVYTYEYVREGVHALY
GFPTREERNLFAKLLQVSGIGPKGGLAILAAGRPDELARAIEEENEAFLCKFPGVGKKTA
RQMILDLKGKLGALAAPAAARSAAPLSGALAEAVAALKALGYAEREIEKIIPALREEAMS
TEQYVKRALALLLG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagtttatccgtgggtatgtcgattacgtctgcccggaatatatcgtcatcgac
cataacggcatcggctacgagatctttacgccgaacccgtttgcgtttcaggaaagccgc
gaggcggcggtgaccgtctatacatacgaatatgtacgcgaaggtgtgcacgccttgtac
gggttcccaacgcgcgaggagcgcaacttgttcgccaagctgctgcaagtgtcgggcatc
gggccgaaaggcggcctcgccattttggcggccgggcgtccggatgaactggcgcgggcc
atcgaggaagaaaacgaggcgtttttatgcaagtttccaggcgtgggcaaaaagacggcc
cggcaaatgattttggatttaaaagggaagctcggggcgcttgcggcgccggcggctgca
cgttcggccgcaccgctttccggtgcgctcgccgaggcggtggcggcgctcaaggcgctc
ggctacgctgaacgggagatcgagaaaatcattccggcgctccgcgaagaagcgatgtcg
acggaacagtatgtgaagcgggcgctggcgctgcttttgggataa

DBGET integrated database retrieval system