KEGG   Geobacillus kaustophilus: GK2643Help
Entry
GK2643            CDS       T00217                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase (porphobilinogen synthase)
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00860  Porphyrin and chlorophyll metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GK2643
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     GK2643
Exosome [BR:gka04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GK2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF3502
Motif
Other DBs
NCBI-ProteinID: BAD76928
UniProt: Q5KWK8
Position
complement(2659778..2660752)
Genome map
AA seq 324 aa AA seqDB search
MALSFDRHRRLRQTAAIRAMVRETHLRVEDLIYPLFVVEGSGIKREVPSMPGVYHLSLDR
LSEEVDDIAKLGIPAVMVFGVPNEKDEVGSQAYCETGIVQRAIRQIKAEHKDLVVIADTC
LCEYTSHGHCGVVENERVLNDPSLELLTKTAVSQAQAGADIIAPSNMMDGFVAAIRRGLD
EAGFEYVPIMSYAIKYASAFYGPFRDAADSAPQFGDRKTYQMDPANRLEAFREAESDVKE
GADFLMVKPALAYMDIIRDVKNRFPLPLVAYNVSGEYAMVKAAAQNGWIDEKSVVMEMLT
GMKRAGADLIITYFAKDVARWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtcatttgaccgccatcgccgtttgcggcaaacggctgcgattcgggcgatg
gtgcgtgagacgcatcttcgcgtcgaggatctcatttatccgctgtttgtggtcgaggga
agcggcattaagcgggaagtgccgtcgatgccaggggtttaccatttatcgcttgaccgt
ttatccgaggaagtggacgacatcgccaagcttggcattcccgccgtcatggtgtttggc
gtgccaaatgaaaaagatgaagtcggttcgcaggcgtattgcgaaacagggattgttcag
cgggcgatccgccaaatcaaagctgaacacaaagatctagtcgtcattgcggatacgtgt
ttatgtgaatatacgagccacggccattgcggcgtcgtcgaaaacgagcgcgtgctgaac
gacccgtcgctcgagctcctcaccaaaacggcggtgagccaagcgcaagccggcgccgac
atcatcgcgccgtcgaacatgatggacggctttgtcgccgccattcgccgtgggcttgat
gaagcagggtttgagtatgtgccgatcatgtcgtatgcaatcaaatacgcttcggcattt
tacggcccgttccgtgatgccgccgacagcgcgccgcagtttggcgaccggaagacgtac
caaatggatccggccaaccgccttgaggcgtttcgcgaggcggagtcggatgtcaaagaa
ggcgctgatttcttgatggtgaagccagcgcttgcctacatggatattatccgcgacgtc
aaaaaccgttttccgcttccgcttgtcgcctataacgtgagcggcgagtatgcgatggtc
aaagcggcggcgcaaaacggctggatcgatgagaagtcggtcgtcatggaaatgttgaca
gggatgaaacgggcgggcgcggatttgatcattacgtattttgccaaagatgtcgcccgc
tggctggctgaatag

DBGET integrated database retrieval system