KEGG   Geobacillus kaustophilus: GK2644Help
Entry
GK2644            CDS       T00217                                 

Definition
uroporphyrinogen III cosynthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gka  Geobacillus kaustophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GK2644
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GK2644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2660753..2661523)
Genome map
AA seq 256 aa AA seqDB search
MANRALAGKTVLVTRDKRQAASFSAKLRAVGAVPIEIPLIAIRPAAAPEAIAALAGRLGE
YRWLVLTSVNAVRFFFPHVSLPRPLPNVAVVGRKTAAALVEYGVSPALVPDDFTAERLAA
MLAPRVKQGDRVLFVKGDLASPTLPEALRKAGAAVDEFTVYQTVPDLSGREPLLALLRER
KLDAITLMSPSAVHSLARLLGEEASALLSGVAVACIGPVTKKAAEREGITVHICPADYTT
DGIIKAMEQYFSMEGR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccaatcgcgccctagccggcaagacggtacttgtcactcgtgacaaaaggcaggcg
gcatcgttttccgccaagctgcgcgccgttggcgccgtgccgatcgaaatcccgctcata
gccatccgcccggcggctgcgccggaagccatcgccgcgctcgccggacggctcggggaa
taccgctggctcgtgttgacgagcgtgaacgcggtccgcttcttttttccgcacgtttcg
ttgccgcggccgctgccgaatgtcgccgtcgtcgggcggaagacggcggccgcgctcgtt
gagtacggtgtttcaccggcgctcgtaccggatgatttcaccgctgaacggcttgccgcc
atgcttgcaccgcgcgtaaaacaaggcgaccgggtgctgtttgtcaaaggtgatttggca
agcccgacgctgcctgaggcgttaaggaaggcaggcgcagcggtcgatgagtttacggtt
tatcaaacggtgccagacctaagcggtcgagaaccattgttggcgttgctgcgcgaacgg
aaactagatgcgattacgttgatgagcccatcggcggttcatagccttgcccgccttctt
ggcgaggaagcgtccgcgcttctctccggcgtcgctgtcgcctgcatcgggccggtgaca
aaaaaggcggcggagcgggaaggaatcaccgtacatatttgtccagctgattacacgacg
gatggtataatcaaagcgatggaacaatatttttccatggagggacgatga

DBGET integrated database retrieval system