KEGG   Geobacillus kaustophilus: GK2688Help
Entry
GK2688            CDS       T00217                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gka  Geobacillus kaustophilus
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GK2688
  Lipid metabolism
   00071 Fatty acid degradation
    GK2688
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GK2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2708667..2709440)
Genome map
AA seq 257 aa AA seqDB search
MDFFRLAKEEFVAVVTFSRPPANALSSAVLKELSTVLDELETDPDVRVVLLHGEGRFFSA
GADIKEFTSIASVEEASGLSRNGQLVMERIERFSKPVIAAIHGAALGGGLELAMSCHIRV
VAENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTSEPITGLEAVEWGLANKAV
PEERLLDEAKALAKKIAAKSPLSVRATIELLNAAKEKSFAEAVREEAEWFGRVFVSEDAK
EGVQAFLEKRPPVFKGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttcgtttggcgaaagaggagttcgtcgccgtcgtgacgttttcgcggccg
ccggcgaacgccctttcatcagcggttttgaaagagctttcaaccgtgttggacgagctc
gagaccgacccggacgtgcgcgtcgtgttgcttcatggcgaggggcggtttttctcagcc
ggcgccgatattaaagaattcacgtccatcgcttccgtcgaggaggcatccggcttgtcg
cgcaacggccaactcgtgatggagcggatcgaacgcttttccaaaccagtcattgcggcg
attcacggcgccgcattaggcggtgggttggagctggctatgagctgccacattcgtgtg
gtggcggaaaacgccaaactcggccttccggagctgcagcttggcatcatccctggattt
gctggcacgcagcggcttgtgcgctacgtcggctttggcaaagcggcggaaatgatgtgg
acgagcgagccgatcaccggactcgaagcggttgaatgggggcttgccaacaaggcggtg
ccggaagagcggcttcttgatgaagcaaaagcgttggcgaaaaagattgccgccaaaagt
ccgctttccgtccgtgcgacgattgaactgctcaacgccgcgaaggaaaaatcgtttgcc
gaggcagtgcgcgaggaagcggaatggtttggccgcgtgtttgtatccgaggatgcaaaa
gaaggcgtgcaggcatttttggaaaaacggccgcctgtctttaaagggaaatga

DBGET integrated database retrieval system