KEGG   Geobacillus kaustophilus: GK2701Help
Entry
GK2701            CDS       T00217                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gka00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:gka00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:gka02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2723970..2725250
Genome map
AA seq 426 aa AA seqDB search
MFQSKRRTALLIAVLSAGLALHQAEQDAWAAPAKQSKPSEVKNVVLFVGDGMGTAHRNAI
RLATKGIAGELEMDDMPYSGLVHTNSADSKSFITDSAAAATAIASGVKTYNGAISVDLQG
KPVETILEQAKKAGKATGLVTTAQVTDATPAAFAAHTANRSAQSDIAKQYIEQTKVDVIL
GGGEDYWYPAGNPGYYPDHPAEDPEEASKGTQGNLVERAKQLGYTYVRTADELKQASGRK
LLGLFANEEMFQQRPEGEGDVYNPVVPLPDMTKKALDVLSQNKKGFFLVVEEEAIDEMSH
ENNGSLMIKAGQQLDEAVAVAKQYAKRHRDTLVLVLADHECGGLTIETPGGTDESGDGKT
ISGEDGPFPIARSTQTFALDWTTTGHTAADVPLTAMGPGAERFTGIYENTRIHDILEQLL
FGKSRR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttccaatcgaaacgccgcacggctttgctcatcgccgtgctgagcgccggactggcg
ctgcatcaagccgaacaagatgcatgggccgccccagcgaaacaatcgaagccgtctgag
gtgaaaaatgtcgtcctttttgtcggcgacggcatgggcacagcgcatcgcaacgccatt
cgccttgccacaaaagggatcgctggagaattggagatggacgatatgccatacagcggg
cttgtccatacgaactccgccgactcgaagtcattcatcaccgactccgctgcggcggcg
accgcgatcgcctcaggcgtgaaaacgtacaacggcgccatctctgttgatctgcaagga
aaaccagtggaaacgattttggaacaagcaaaaaaagccggcaaggcaacagggcttgtc
acgaccgcccaagtgacggacgccacgccggctgcgtttgccgcccacaccgccaatcgc
tctgcccaaagcgacatcgccaagcaatacatcgaacaaacgaaagtggatgtcattttg
ggcggcggggaagattactggtatcctgctggaaatcctggctattaccccgaccatcca
gccgaagatccggaagaagcaagcaaaggcacgcaaggaaacttggttgaacgcgccaag
cagctcggctacacgtacgtccgcaccgccgatgagctgaaacaagcgtccggccgcaag
ctgcttggactgtttgccaacgaagaaatgttccagcagcgccccgaaggagaaggagat
gtgtacaatcccgttgtgccgctgcccgatatgacaaaaaaagcgcttgacgtgctgtcg
caaaataaaaagggctttttcctcgttgtcgaagaagaagccattgatgaaatgagccat
gaaaacaacggatcgctcatgatcaaagcgggccagcagcttgatgaagcggtcgccgta
gcgaaacagtacgccaagcgccatcgggatacgctcgtcctcgtgctcgctgaccatgaa
tgcggcggcttgacgatcgaaacgccgggcggcacggatgagtcgggagacggcaaaacg
atctccggcgaagacggtccgtttccaattgcccgctctacgcaaacgttcgccctcgac
tggacgacaacgggccacaccgccgccgatgtgccgctgaccgccatgggcccgggagcg
gagcgattcaccggcatttatgaaaatacgcgcattcatgacattctcgaacaattattg
tttggaaaaagcagaagataa

DBGET integrated database retrieval system