KEGG   Geobacillus kaustophilus: GK2713Help
Entry
GK2713            CDS       T00217                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gka  Geobacillus kaustophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GK2713
Enzymes [BR:gka01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GK2713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2735400..2736488)
Genome map
AA seq 362 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGIGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTF
DE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggacgaaacgttgacgatgctgaaagcgctgaccgatgcgaaaggcgtc
ccgggcaatgagcgggaagcgcgcgatgtgatgaagacatacatagctccgtatgcggat
gaagtgacaacggatggcctcggcagcttgattgccaaaaaagaagggaaatcgggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgac
gacaaaggattcatccgcttccaaacgcttggcggatggtggagccaagtgatgctcgcc
cagcgcgtgacgatcgtgacgaaaaaaggcgacatcaccggcgtcatcggttcgaagccg
ccgcacattctgccgccggaggcgcgcaaaaaaccggtggaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggagtggggcgtccgcccgggcgatatg
atcgtgccgtattttgaatttacggtattgaacaatgaaaaaatgctgctcgcgaaagca
tgggacaaccggatcggctgtgcggtcgccatcgatgtgctcaagcagttaaaaggcgtc
gaccatccaaacacggtatacggcgtcggcacggtgcaggaagaagtcggcttgcgcggc
gcgcgcacggccgcccaattcattcagccagatatcgcgtttgctgttgacgtcggcatt
gccggcgacacgccgggggtgtcggaaaaagaagcgatgggcaaactcggcgccggcccg
cacatcgtcttgtacgacgcaacgatggtgtcgcaccgcggcttgcgcgaatttgtcatc
gaagtggcggaagagctgaacattccgtaccattttgatgccatgccaggcggcggtacg
gacgcgggagcgattcacttaaccggcatcggcgttccgtcgctcacgattgccatcccg
acgcgctacatccactcgcacgccgccattttgcaccgcgacgactacgaaaacacggtc
aagctgcttgttgaggtgatcaaacggcttgacgccgacaaagtgaaacaactgacgttt
gacgaataa

DBGET integrated database retrieval system