KEGG   Geobacillus kaustophilus: GK2759Help
Entry
GK2759            CDS       T00217                                 

Definition
(GenBank) acetyl-CoA synthetase (acetate-CoA ligase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00010  Glycolysis / Gluconeogenesis
gka00620  Pyruvate metabolism
gka00640  Propanoate metabolism
gka00680  Methane metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK2759
   00620 Pyruvate metabolism
    GK2759
   00640 Propanoate metabolism
    GK2759
  Energy metabolism
   00680 Methane metabolism
    GK2759
Enzymes [BR:gka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GK2759
Lipid biosynthesis proteins [BR:gka01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GK2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAD77044
UniProt: Q5KW92
Position
2782274..2783932
Genome map
AA seq 552 aa AA seqDB search
MANHLSPASIIQSFSWDQAFAHYDGDPRGRFNAAHEVCDRYAEDPNRIALFYENALGEQK
TITYRQLRDWSNQMANVFRKLGVKKGDRVCALMPKNPALVVYILAAWKVGAVYVPLFTAF
GPQAIEYRINHSEAKVLLTNKEQRAKLPPRDNMPTLEHIFVIDGSSHDQDQPFWETLSSM
PTEHSIEETTVDDLLAIQYTSGSTGMPKGAMWPHNVLINIYPYMRYAIGLRDDDVFFGGA
DPGWAYGLIFCTFAPMAFGVPIVFYEGPFKPETCYSLMEKYRVTNFAYAPTAYRAMAAAG
ADVIRRYQLNVRAMSSAGEPLNPEVIRFFQEHVGVTIHDHYGLSETLMLIGNFNAAEMEI
RPGSMGWPLPGFDVALLDENGTPVADGEVGQIAFNTDSIPNVFKGYWKDPEKTAERLIGK
WFLTGDLATKDEDGYFWFQGRADDIISSAGYRIGPFEIESCLLEHPAVVEAAAVGKPDPV
KGEIVKAFVVLREGFAPSDELAEELSLFVKTRLSKHEYPREVEFVTELPKTPSGKIQRFI
LRNQEREKQKKA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccatctatcacccgcttctatcattcaatcgttttcttgggatcaggcattc
gcccactacgacggcgatccgcgcggacggttcaacgccgcccacgaagtatgcgaccgg
tatgccgaggatccgaatcgcattgcgctgttttatgaaaacgctttaggagagcaaaaa
acgatcacctatcggcaattgcgcgattggtcgaaccaaatggcgaacgtgttccgcaag
ctgggcgtgaaaaaaggggatcgcgtctgcgcgctgatgccgaaaaacccggcccttgtc
gtctacattttggcggcttggaaagtcggcgccgtgtatgtgccgctctttaccgcgttt
ggcccgcaggcgattgaatatcgcatcaaccattccgaggcgaaagtcctcttgacgaac
aaggaacagcgcgccaaactgccgccgcgggacaacatgccgacattggagcacattttt
gtcattgacggatcgtctcatgatcaagaccagccattttgggaaacgctttcatcgatg
ccgactgagcactcgatcgaagaaacgacggtcgacgatctgctcgcgattcagtatacg
tccggctcgaccgggatgccaaaaggcgccatgtggccgcataacgtgctcatcaacatt
tatccgtatatgcgctatgcgattggcctacgcgatgacgatgtctttttcggcggggcg
gatccgggctgggcgtacgggctgatcttttgcaccttcgcgccgatggcctttggcgtg
ccgatcgtcttttacgaagggccgtttaagccggagacgtgctattccttgatggaaaaa
taccgggtgaccaatttcgcgtacgccccgaccgcgtatcgggcgatggcggcggccggc
gcggacgtcattcgccgctatcaactgaacgtgcgcgccatgagctcggcgggcgagccg
ctcaatccggaagtcatccgctttttccaagagcacgtgggcgtcacgatccacgaccat
tatggcttgtcggaaacgttgatgctgatcggaaacttcaacgccgccgagatggaaatc
cggccaggctcaatgggatggccgctgccgggctttgacgtcgccctgctcgatgagaac
ggaaccccagtcgccgacggcgaagtcggacaaattgcctttaacaccgactcgatcccc
aacgtctttaaggggtattggaaagaccctgaaaaaaccgccgaacggcttatcggcaag
tggtttttgaccggcgatttggcgacaaaagacgaagacgggtatttctggttccaagga
cgggcggacgacatcatctcgagcgccggctaccgcatcgggcctttcgaaattgaaagc
tgcctccttgagcatccggctgtcgtcgaagcagccgccgtcgggaagccggatcccgtc
aaaggggaaatcgtcaaagcgttcgtcgtgctcagagaaggctttgcgccgtcggacgag
ctggccgaagagctgtccttgttcgtcaaaacgcgcttatccaaacatgaatacccgcgc
gaagtcgaatttgtcaccgaattgccgaaaacgccgagcggaaaaatccagcggttcatc
ctgcgcaatcaagaaagggaaaagcagaaaaaagcctaa

DBGET integrated database retrieval system