KEGG   Geobacillus kaustophilus: GK2827Help
Entry
GK2827            CDS       T00217                                 

Definition
pullulanase (EC:3.2.1.68)
Orthology
K01200  
pullulanase [EC:3.2.1.41]
Organism
gka  Geobacillus kaustophilus
Brite
Enzymes [BR:gka01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.68  isoamylase
     GK2827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2853245..2855401)
Genome map
AA seq 718 aa AA seqDB search
MLHISRTFAAYLDEMDQIVVLAPKSLGFDGMAPFTLVAPSGEEIPLSVQHVEDVGETVKY
VCRFASAFEFGATYWVRSCRGEETDVQIGAVVRTPAFDDRFFYDGPLGAEYLKEQTVFRV
WAPTATAVSVKLVHPHLDEIRCVPLVRGERGVWSAVVPGDWERARYTYIACINRVWREAV
DPYATAVSVNGEFGVVIDWEKTKLAPPSLPLPPLCSPTDAIIYELSIRDFTSHPDSGAVH
KGKYLGLAETNTSGPNGTATGLSYVKELGVTHVQLMPFMDFAGVDERDPQAAYNWGYNPL
HLYAPEGSYATDPADPYARIVELKQAIHTLHENGLRVVMDAVYNHVYDREQSPLEKLVPG
YYFRYDAYGQPANGTGVGNDIASERRMARRWIVDSVVFWAKEYGIDGFRFDLMGVHDIET
MKAVRDALDAIDPSILVYGEGWDLPTPLPPEQKATMANAKQLPRFAYFNDRFRDAVKGST
FHLPDRGFALGNPGGREQVKLAIAGSLRALGGLFCHPRQSINYVECHDNHTFWDKMEAAN
HDEPEWLRRKRQKLATAIVLLAQGIPFLHSGQEFYRTKGGDGNSYRSPDAVNQLDWERKS
RYEDDVRYVQGLIALRRAHGAFRLATEAEVLRHFTFLEPLPPSVIAYRLHDAAVYGPWED
IIVVHHNEEKETAIALPDEREWAVVCDGQRCGTTPFGQARGMLRLDGIGTWVLVHPAG
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacatcagccgaacgtttgccgcctatttggacgagatggatcaaatcgttgtg
cttgcgccgaaatcgctcggctttgatggaatggcgccgtttacgctcgtggcgccgagc
ggcgaggagattccgctgtccgtgcagcacgtcgaggatgttggggagacggtgaaatat
gtgtgccggtttgcatccgcgttcgagtttggagcgacatactgggtgcgttcttgccgc
ggggaggagaccgatgttcaaatcggcgccgttgtgcgcactcctgcatttgatgatcgg
tttttctatgatggaccgttaggagcggagtatctcaaagaacagacggtatttcgcgta
tgggcgccgaccgccaccgcggttagcgtcaagctggttcatccgcatctcgacgagatc
cgctgcgtgccgcttgtgcgcggcgaacgcggcgtatggtcagccgtcgtccccggcgat
tgggagcgagcgcgttacacatatatcgcctgcatcaaccgcgtatggcgcgaggcagtg
gacccgtatgcgaccgcggtttcggtcaatggcgagttcggcgtcgtgatcgactgggag
aaaacgaagctggcgccgccctctttgccgcttccgccgctctgttcgccgacggatgcc
atcatttatgagctgagcatccgcgactttaccagccacccggacagcggcgccgtccat
aaagggaagtatctcgggctggccgaaacgaacacgagcgggccgaacgggacggccacc
gggctttcgtatgtcaaagagctgggcgtcacccatgtgcagctcatgccgtttatggac
tttgcgggcgtcgatgagcgcgacccacaagcggcttacaactggggatacaatcccctt
catctatatgcgccggaagggagttatgcgaccgatccagcggatccatacgcgcgcatt
gtagaattgaagcaggcgatccacacgctgcacgaaaatggcttgcgcgtcgtgatggat
gcggtctacaaccatgtctatgaccgggagcaatcgccgcttgagaagctcgttcccggt
tattacttccgctacgacgcctatggccaaccggccaacggcaccggcgtcggcaacgac
atcgcttcggagcggcggatggcgcgccgctggatcgtcgattcggtggtgttttgggcg
aaagaatatggcattgacgggttccgctttgatttgatgggcgtgcacgatatcgagacg
atgaaagcggtgcgcgatgccctcgacgctatcgatccgtcgatccttgtgtatggggaa
gggtgggatttgccgacgcctcttccaccggaacaaaaggcgacgatggccaacgccaag
cagctgccgcgcttcgcttatttcaatgaccggtttcgcgatgcggtgaaagggagcacc
tttcatttgccggaccgtgggttcgccctcggcaacccaggcgggcgagaacaggtgaag
ctcgccattgccgggagcttgcgagcgctcggcgggctgttttgccacccgcgtcagtca
atcaattacgtcgaatgtcatgacaaccatacgttttgggataagatggaggcggccaac
catgatgagccggaatggctccggcgaaagcggcaaaagctggcgacggcgatcgttctg
ttggcgcaaggcattccgtttttgcacagcggccaagagttttatcggacgaaaggcggc
gatgggaacagctaccgatcgccggatgcggtcaatcagctggattgggagcggaaaagc
cgctatgaagacgacgtccgctacgttcaaggattgatcgcccttcgccgtgcgcatggc
gcatttcgcctcgccacggaggcggaagtgctgcgtcatttcacgtttcttgagccgctg
ccgccgtcggtcatcgcctaccgattgcatgatgccgccgtctatgggccttgggaggac
atcatcgtcgtgcatcataacgaggagaaagagacagccattgcgctccccgacgagcgc
gagtgggcggttgtatgcgacggacagcgatgcgggacaacgccctttggccaagcgcgc
ggcatgcttcggcttgacggcatcggcacatgggtgctcgtccatcctgcagggtga

DBGET integrated database retrieval system