KEGG   Geobacillus kaustophilus: GK2963Help
Entry
GK2963            CDS       T00217                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GK2963
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GK2963
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GK2963
Enzymes [BR:gka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GK2963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2989383..2990444)
Genome map
AA seq 353 aa AA seqDB search
MAWKGLLDAYGDFLPLSAATPRLSLCEGNTPLIPLPRLSEELGIALYVKVEGANPTGSFK
DRGMVMAVAKAKEEGSHTIICASTGNTSASAAAYAARAGMRCLVVVPNGKIALGKLAQAA
MYGAEIFAIDGNFDEALKMVRRLSETAPITLVNSVNPYRIEGQKTAAFEVCDQLGRAPDV
LAIPVGNAGNITAYWKGFKEYHEAKGTGLPQMRGFEAEGAAAIVRNRVIEQPETVATAIR
IGNPASWDKAVEAASESRGKIDEVSDAEILAAYKRLARTEGIFAEPASCAAIAGVIKQRE
RNEIERGSLVVAVLTGNGLKDPAIALETAAIEPIVLPNDEQVVLEHLQGVVRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatggaaagggctgcttgacgcctacggcgattttttgccgctctctgcggcgacg
ccgaggctgtcgctttgcgaagggaatacgccgctcatcccgctgccgcgcttgtcggag
gagctcggcattgcgctctatgtcaaggtcgaaggggcgaacccgaccggttcgtttaaa
gaccgcggcatggtgatggcggtggccaaggcgaaagaggaaggaagccatacgatcatc
tgcgcctcaaccggcaatacatcggcttcagcggccgcctacgcggcgcgcgccggcatg
cgctgcctcgtcgtcgttccgaacggcaagatcgccctcggcaagttggcgcaagccgcc
atgtacggcgcggaaatttttgcgattgacggcaactttgacgaggcgctgaagatggtg
cgccggttgagcgaaacggcgccgattacgctcgtcaactcggtcaatccgtaccggatc
gaagggcaaaaaacggcggcgtttgaagtgtgcgaccagcttgggcgcgccccggacgtg
ctcgccattccagtcggcaacgccggcaacatcaccgcctattggaaagggtttaaggag
taccatgaagcgaaaggaacgggcttgccgcaaatgcgcggctttgaagcggaaggagcg
gcggcgatcgtccgcaaccgggtgattgaacagccggagacggtggcgaccgcgatccgc
atcggcaatccggcgagctgggacaaagcggtcgaggcggcgagcgagtcgcgcgggaaa
attgatgaggtgagcgacgcagaaattttggccgcctacaagcggctcgcccggacggaa
ggcatttttgccgaaccggcgtcatgcgcggcgatcgccggggtgatcaagcagcgcgaa
cggaacgaaatcgaacgcggcagcctcgtcgtcgcggttctcactggcaacggattgaaa
gacccggccatcgccttggagaccgcggcgatcgaaccgatcgtgctgccgaacgatgaa
caagttgtcttggagcatttgcaaggggttgtccgggcatga

DBGET integrated database retrieval system