KEGG   Geobacillus kaustophilus: GK3045Help
Entry
GK3045            CDS       T00217                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gka  Geobacillus kaustophilus
Brite
Enzymes [BR:gka01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GK3045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3067043..3067783)
Genome map
AA seq 246 aa AA seqDB search
MKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEEL
VHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPIQGIVTMCAPMYI
KSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDLV
YAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttccgccgaagccgtttttctttgaagccggggagcgggcggtgctgctt
ttgcatgggtttaccggcaattccgccgacgttcggatgcttgggcgattcttggaatcg
aaagggtatacgtgccacgctccgatttacaaagggcatggcgtgccgccggaagagctc
gtccacaccggaccggatgattggtggcaagacgtcatgaacggctatcagtttttgaaa
aacaaaggctacgaaaaaattgccgtggctggattgtcgcttggaggcgtattttctctc
aaattaggctacactgtacctatacaaggcattgtgacgatgtgcgcgccgatgtacatc
aaaagcgaagaaacgatgtacgaaggtgtgctcgagtatgcgcgcgagtataaaaagcgg
gaagggaaatcagaggaacaaatcgaacaggaaatggaacggttcaaacaaacgccgatg
aagacgttgaaagccttgcaagaactcattgccgatgtgcgcgcccaccttgatttggtt
tatgcaccgacgttcgtcgtccaagcgcgccatgatgagatgatcaatccagacagcgcg
aacatcatttataacgaaattgaatcgccggtcaaacaaatcaaatggtatgagcaatca
ggccatgtgattacgcttgatcaagaaaaagatcagctgcatgaagatatttatgcattt
cttgaatcgttagattggtaa

DBGET integrated database retrieval system