KEGG   Geobacillus kaustophilus: GK3056Help
Entry
GK3056            CDS       T00217                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gka  Geobacillus kaustophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GK3056 (tpiA)
   01230 Biosynthesis of amino acids
    GK3056 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GK3056 (tpiA)
   00051 Fructose and mannose metabolism
    GK3056 (tpiA)
   00562 Inositol phosphate metabolism
    GK3056 (tpiA)
Enzymes [BR:gka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GK3056 (tpiA)
Exosome [BR:gka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GK3056 (tpiA)
  Exosomal proteins of bladder cancer cells
   GK3056 (tpiA)
  Exosomal proteins of melanoma cells
   GK3056 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3076398..3077159)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVENVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTP
EDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEQIDGALVGGASLEP
ASFLQLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagccgtt
caatttgtcgagaacgtaaaagggcacgtgccgccggccgacgaagtcgattccgtcgtt
tgcgcgccgtttctctttttggatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgatcaaggggcgtacacaggcgaagtgagcccg
gtcatgctgaaagacctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgccgaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggg
cttataccgattatttgctgcggcgaatcgcttgaggagcgggaagcggggcagacgaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggaacaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcgggacgggcaaatcatcaacaccg
gaagacgccaacagcgtctgcggccatatccgttcggttgtttcgcgcctgtttggcccg
gaggcggcggaagcgatccgcattcaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacagatcgacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcggggcgccatgagtaa

DBGET integrated database retrieval system