KEGG   Geobacillus kaustophilus: GK3269Help
Entry
GK3269            CDS       T00217                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gka  Geobacillus kaustophilus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GK3269
   00052 Galactose metabolism
    GK3269
   00500 Starch and sucrose metabolism
    GK3269
   00520 Amino sugar and nucleotide sugar metabolism
    GK3269
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GK3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3310798..3311685)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAKGSKNN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccggcggccgggcttgggacgcggtttttgccg
gcgacgaaggcaatgccgaaggagatgcttccgatcgttgataagccgacgattcaatat
attgtcgaagaagccatcgcctcaggcattgaggacatcatcatcgtcaccgggaaaggg
aagcgggcgattgaggatcattttgactacgcgtttgagctggaacagatgctcaagcaa
aaagggaagctggatctgcttgagaaagtgaaagagccgtcgaaggtggacatccactac
attcgccaaaaagagccgaaagggctcgggcatgcggtttggtgcgcgcgcaatttcatt
ggagacgagccgtttgcggtgttgttgggcgatgatatcgtccaggcggaaaagccttgt
ttaaaacagctcattgagcagtatgaacaaacgttcagctcggtgattggtgtcaagcgc
gtgccggaggaagaaacacatcgctacgggatcatcgacccgctcgagcagcaaggccgg
cgctaccaagtgcgccgcttcgtggaaaaaccagctccgggcacagcgccgtcgaacttg
gcgatcgtcggccgctacgtgttgacgccggaaattttcttgtttttagagaaacaggaa
gccggcgcaggcggggagattcagctcaccgatgcgatcgggcggttgaatgaaattcag
cgcgtgtttgcctatgaatttgaaggaaagcggtacgatgtcggcgaaaagctcggcttt
atcgaaacgacgattgagtttgccttgcaaaacgaggagctgcgggatgacttgctttcg
tttttggagcgggtggtggcagaggcgaagggatcgaagaacaactaa

DBGET integrated database retrieval system