KEGG   Geobacillus kaustophilus: GK3320Help
Entry
GK3320            CDS       T00217                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00040  Pentose and glucuronate interconversions
gka00052  Galactose metabolism
gka00500  Starch and sucrose metabolism
gka00520  Amino sugar and nucleotide sugar metabolism
gka01100  Metabolic pathways
gka01130  Biosynthesis of antibiotics
Module
gka_M00362  Nucleotide sugar biosynthesis, prokaryotes
gka_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gka00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GK3320
   00052 Galactose metabolism
    GK3320
   00500 Starch and sucrose metabolism
    GK3320
   00520 Amino sugar and nucleotide sugar metabolism
    GK3320
Enzymes [BR:gka01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GK3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAD77605
UniProt: Q5KUN1
Position
complement(3365841..3366725)
Genome map
AA seq 294 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVASGIEDIIIVTGKG
KRAIEDHFDNAFELEQNLIQKGKYDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAETPCLKQLIDQYEQTLSSVIGVKRVPDNETHRYGIIDPIEQHGR
RYQVRQFVEKPAPGTAPSNLAIMGRYILTPEIFLFLEKQEAGAGGEIQLTDAIQKLNEIQ
RVFAYEFEGKRYDVGEKLGFIQTTIEFALQHDELREDLIQFMEKLLNDVKVEEK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccagcagcggggctcggcacaagatttttgcca
gcgacgaaagcgatgcctaaggaaatgcttccgattgtcgataaaccgacgattcaatac
atcgtcgaagaagcggtcgcctctggcatcgaagatattatcatcgtcacaggaaaagga
aaacgcgcgatcgaggaccatttcgacaacgcttttgagcttgaacaaaacttaattcaa
aaaggcaaatacgacttactcgaaaaagtaaaagagccatcgaaagtcgacattcactac
attcgccaaaaagaaccgaaagggctcggccacgccgtctggtgcgcgcgcaactttatc
ggcgacgaaccgtttgccgttctgcttggtgacgacatcgtccaagcggaaacaccatgc
ttaaaacaattaattgaccaatatgaacaaactctcagttccgttattggtgtcaaaaga
gtgcctgataacgaaacgcaccgttacggcatcatcgatccaattgaacaacacggacgc
cgctaccaagtccgccaattcgtcgaaaaaccagcgcccggcaccgcgccgtccaactta
gcgattatgggacgatacatactcacgccggaaatcttcttgttccttgaaaaacaagaa
gccggcgccggcggcgaaatccagctcaccgacgcgattcaaaaattgaacgaaattcaa
cgtgtcttcgcctacgaattcgaaggcaagcgctacgatgttggcgagaagctcggattt
atccaaacgacgattgagtttgcgttgcagcatgatgaattaagagaagaccttattcaa
ttcatggagaaactattaaatgatgtgaaagtagaagagaaataa

DBGET integrated database retrieval system