KEGG   Geobacillus kaustophilus: GK3404Help
Entry
GK3404            CDS       T00217                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gka  Geobacillus kaustophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gka00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3446206..3447081)
Genome map
AA seq 291 aa AA seqDB search
MRFDEAYSGNVFIGSHPNFEESEAVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELKDIRYFDAGDIPLPFGNAARSLELIEQFVKKVLDAGKFPLGLGGEHLVSWPVIK
AVHDYYPDLAVIHMDAHTDLREHYEGEPLSHATPIRKVADLIGPTNVFSFGIRSGMKEEF
EWAKENGMYIAKFEVLEPLRSVLPKLAGRPVYVTIDIDVLDPAHAPGTGTVDAGGITSKE
LLAAIHEIARSDVHVVGADLVEVAPIYDHSEQTANTASKLVREMLLGWVAK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcgggcaacgtctttattggcagccacccgaacttcgaa
gagagcgaagcggtcatttacggcatgccgatggactggacggtcagctaccggcctggc
tcgcggtttggcccggcccgcatccgcgaagtgtcaatcgggcttgaggagtacagccca
tatttggaccgcgaactcaaagacatccgctactttgacgctggggacattccgctcccg
tttggcaatgcggcccgcagtttagagctgattgagcagttcgtgaaaaaggtgcttgac
gccggcaaatttccgctcggccttggcggcgaacatctcgtctcttggccggtcatcaaa
gcggtgcacgactattacccagatttggccgtcattcacatggacgcccataccgacttg
cgcgaacattacgaaggcgagccgctgtcgcacgcgacgccaatccgcaaggtcgctgac
ctgatcggcccgacgaatgtcttttcgttcggcatccgctccggcatgaaggaagagttc
gaatgggcgaaagaaaacggcatgtacatcgccaagtttgaggtgctcgagccgctccgc
tccgtgctgccgaagctcgccggccgcccagtgtatgtgacgatcgacatcgatgtgctt
gatcccgctcatgcccctggcacaggaacggtggatgccggcgggattacgtccaaagag
ttgctagcggccattcacgagattgcccgctctgacgttcatgtcgtcggcgctgatttg
gtcgaagtggcgccgatttacgaccactcggaacaaacggccaatacggcgagcaagctt
gtgagagaaatgctgcttggctgggtggcgaagtga

DBGET integrated database retrieval system