KEGG   Giardia lamblia: GL50803_102108Help
Entry
GL50803_102108    CDS       T01047                                 

Definition
Clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
gla  Giardia lamblia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:gla00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GL50803_102108
Exosome [BR:gla04147]
 Exosomal proteins
  Proteins found in most exosomes
   GL50803_102108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1871 aa AA seqDB search
MASALSINELFTLRDAQVPEGSCSPEHLTVSSSSGICVCVTTGEAANLTVVNTVNPQATK
TFPIQAQHAIQHRKNPNIVVLRTPVLLQTLDVSTMTPYGRFDFPNPIGVDYWGWATDEKL
ALVCPDAVYFWNCMTGEFSPGFARDVSLTSTYSNSRITDLAVSSDADWVAITALGTDQAN
HTQGMIQLYCFSRAYTRMLSGQCVTFVDWQLDATRPKTTLLAYAHKPTGSQEITINIMEP
APQVGADGASISGFTTKAVQATVSAALVGVDHPLFLRGKEKYGFLYMFSKQGNVTLVDIY
SGLLIYQGPISGEMVFAIGTCYEGGTFSDTHDFIGITTDGRCYGIGVDKINLVNYVMTKR
GQPDVAYAIALRTGIRGADSLFQQKLDGYLGQYQWSEAAELVKIAPAGVLRTKATIDRFL
AGAAFTAPGAPTPIMIYLTRMLENDGKLAIEEESMELAKFLVQTSNVSTIETYIKEKRFF
ATEGLGDYLASVGLEQPSFTTYANAGCHEKAIAWLIAHNQYAIIPQYAQKFPEYTPDYPR
IISQALKQAEQRPDGASTIESIYQFSLSITQALDATTDGDKILDIADCFADIGRVNEATT
ILLEVCKRYNYSDDTVIYQSMVIELNRGVNQAVVDAIQAKGVLARINRAEITKRSEESGL
YQRAFEFCDSDAECRRIASTYAAKLGKSIFSSPRWYGAYIKRASRFSNPTDDVIKSLFAF
QQQMLEITIGGERIYADHVAMGFALSPIVVSNVSLCVTVVKVFEKYGMGNSEALYLFLSM
IAPTCLDSSIHNFLLRTILQLDSKTLELTHIVAEDQYLDPNECFTIMTTTTPASPDAFLQ
AFLTFCERFHLGKKLGLFLTDSITNKVLGKDTFFTLNAATIVEAFIGGHGVAQAHDLLFG
LFEGGVLAVPERPALDAVFSADMLSKLMEKPAVQAGCDINKVVDACFTSSRTLKVGRSLL
EKRLASGTTDTFVHTAFAKLHMEERNGNAKRLLMEDPYIDHALIGTFILESPTHRTDDFL
VDLAMTSLTIGAFGPTTAGADFSDHIINGECARMLVLVAYAGSAYKELAERLLLHKCSEL
WQLALVGVMNEDPASDVIKAITQGGMRPMSMHRDMLLQVLAHSPPIPLDTLSDAQIFVLS
SSILAIKNESDAIPRYLQAILEKIITSPGSVHASNPGMQNLLIVTALNTKDYPKVSALIR
SADMCYDQDVIAKACVETAKKNEYPPLYEDAFEVFHRAGRPIDAIRVLLDNISIDRGITY
ANSVGLPEVWSLVGSAQLEKASAYASEDNGRFALKFACDAIASYLTGRWTADYRNLIITS
FKVSKAFMHTHSVEVRSELAALLEYLRMARVVVAQKGETSSQAEIDTAVMYCLARLDDYG
ALSEFLESVNPRDSTVIPNRGGIKEVGEKCFAEEHYKAAKYFFEFVGDWSRLSLTLVKLR
CLKEAVEAATRAADPECWKAVAAECLEIRDFELAKSVFLNLVLVESELPSIVQYYEEYGF
IEELLEVLEAGAEQPQAATYTSMETNIFTILAILYCKYMWIVRKTDPQRLQTYIKTHGNK
IHIPTLLHWTRETRLWGEYAYLLAASRDFDKAVVEMIAHPPSSFNHDVMKKVIGRVSNPE
LVAQVVSFYIEYSPEYLCDFLKACQLGVPNADGSPGIPAALDPIRVIAMVRSYDCVPMIK
SYLELFVGAHNQEINETLIKIYLESYDDEGLRRLIAATTAYDAHALLDNLVSEDQTDDMR
KLAVGLYGRLNRYDEGIKFGLQNWFYEDAAECAADSGQIEHCEALLRLVCSSQFPTPKIR
KEVFAVILIRCGHCIRPDVVMELAWVNRMTDYMMPYMISTLQRYGSAVRTLAGSIAEARG
MIPAQQAPQQH
NT seq 5616 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgccttgtctattaatgagctgttcaccttgcgtgacgcgcaggttcccgag
gggtcctgctcccctgagcacttgactgtgtcgtcgtcttctgggatctgtgtatgcgtg
accactggggaggcagcaaatttaactgttgttaacacggttaacccacaggccacaaag
actttccccattcaagcacagcacgcgatccagcacaggaagaaccccaacatcgtggtc
ttgcgcacgccagtcctgctccagaccctcgatgtttccactatgaccccttatggacgt
tttgactttccgaaccccattggagtggactactggggctgggccacggacgagaagctg
gcactcgtctgccccgatgccgtctacttctggaattgcatgacgggagagttttcccca
gggttcgcgcgggacgtgagcttgacgagcacctacagtaactcgcgcatcactgaccta
gccgtctcgtctgacgcagactgggtcgcaatcactgcgctgggcacggaccaggcaaac
cacacacagggaatgatccagctctactgctttagcagggcatatacccgtatgctttca
gggcagtgcgtgacttttgttgactggcagctcgatgcgacaaggccgaaaaccactctt
ctggcgtatgcacacaagcctactgggtcgcaggagatcacaattaacataatggaacct
gcaccacaggttggggctgacggcgcctctatctctggcttcacaacgaaggccgttcag
gccaccgtgagcgccgcgcttgtaggcgtggatcatcctctgttcttgaggggaaaggag
aaatacggttttctttacatgttttccaagcagggcaacgttaccttggtggatatctac
agcggcctcttgatctatcagggccccatttcgggggagatggtctttgctatcggaacg
tgttacgaaggtgggactttttctgatacccatgactttataggcatcaccaccgatggc
cggtgctatgggattggggtggataagatcaatctggtgaactatgtcatgactaagcgt
ggccagccggacgttgcctacgccatcgccttgcgcacggggatccggggcgccgactct
ttattccaacagaagctagatggctatcttggtcagtaccagtggagcgaggctgctgag
cttgttaagatagctccagcaggtgtccttcgcacaaaggccacaatagatcgttttcta
gctggtgctgcgttcactgcaccaggcgcaccaacgccaatcatgatctatcttacgcgg
atgctggagaacgatggcaagctagctattgaagaggagtcgatggagttggcgaagttc
cttgttcagacttctaatgtgagtaccatcgagacgtacattaaggagaagcgctttttt
gcaaccgaagggttgggcgactacttggcgtctgtgggtctcgagcaaccgtcgttcacc
acgtatgctaacgctgggtgccacgagaaggccattgcctggctcattgcgcacaaccaa
tacgctatcatcccacagtatgcacagaagttcccagagtacacgccagactatccacgt
attataagccaggcactaaagcaggcggagcagagacctgatggcgcatccaccatagag
agcatataccagttttcgcttagcatcacccaggcacttgatgcgaccacagacggagat
aagattctagatattgcagattgcttcgctgacatagggagggtgaacgaggctacaaca
atcctcctggaagtttgcaagcgctacaactactccgacgataccgttatctaccagtcg
atggttattgagctcaacagaggggtgaaccaggcagtcgtggatgccatacaggctaag
ggcgtgcttgcaagaattaaccgggcagagataactaaacgcagcgaggagagcggactt
tatcagcgggcgtttgaattctgtgattccgacgcagaatgtcggcgcatcgcatcaacc
tatgctgcaaagctagggaagtcaatcttctcgtcaccacggtggtatggcgcgtatatc
aaacgtgcatcgcgcttttcaaatccaaccgacgatgttattaagagtctttttgccttt
cagcagcaaatgcttgaaataacaataggcggggagcgcatctacgctgaccatgttgcc
atgggctttgctctctctccgatcgttgtttctaacgtcagtctgtgtgttactgttgtc
aaggtctttgagaaatatggaatgggtaactccgaagccctctaccttttcttgtccatg
attgcgcccacgtgcctggattcgtccatccacaacttccttctccgcacaattcttcag
ctggattcaaagactcttgaactcacacacatagtcgctgaagatcagtatctggacccg
aatgagtgcttcaccataatgactaccacgacccctgcaagcccggacgccttcctccag
gctttccttactttttgcgagcggttccatctcggcaagaaactgggtttgttcctaaca
gactccatcaccaacaaggttctagggaaagacacgttctttacactgaacgcagcaacg
attgtagaggcgttcatcggtggacatggagttgcgcaggcgcatgacctcctcttcggt
ctgttcgaaggaggagtgctggcagttccagagaggcctgccctagacgccgttttttca
gcagacatgctcagcaagctgatggaaaagcctgcagttcaggctggttgtgatatcaat
aaggttgtggatgcctgcttcacaagctctcgaactcttaaagtcgggcgctcacttctc
gagaagcgtctagcatccgggacaacagacacgtttgtccacactgcgtttgcgaagcta
cacatggaagagcgcaacggcaatgctaagcgcctcctcatggaggacccttacatcgac
cacgcgctcataggaaccttcattctggagtctccgacacaccggaccgatgacttttta
gtcgatcttgcaatgacatcgctgaccatcggggcttttggaccaacgactgcaggcgct
gatttttctgaccacattattaacggagaatgcgccaggatgctggtcttagttgcctac
gcagggagtgcttacaaggagctggctgagaggctcctcttgcacaagtgtagtgagctt
tggcagctggctcttgtcggagttatgaacgaggacccagcttccgacgtcatcaaagca
atcacgcagggtgggatgcgtccgatgagcatgcacagggacatgctcttgcaggtcttg
gcgcacagcccgccaattcctctcgacacgctcagcgatgcacaaattttcgttctatct
tcgtctattcttgccattaagaatgagagcgatgcaattccaagatatctacaggcgata
ctagaaaagatcatcacttctccgggctctgtgcacgcaagcaatccgggcatgcagaat
cttctcatcgttaccgccctaaatacaaaggactatcctaaggtgtcggcccttattcgc
tctgcagacatgtgctatgaccaggacgtaattgcaaaggcttgcgtggaaacggcaaag
aagaacgagtacccgcctctctacgaggacgcctttgaggttttccaccgcgccgggcgt
cccattgatgccattcgagtacttttggacaacatctccatagaccgtgggatcacttac
gctaactctgtgggccttcctgaagtgtggtccttagttggatcggcccagctcgaaaag
gcaagtgcttatgcatccgaggataatgggcgcttcgcgttgaaatttgcttgtgacgca
atagcatcgtatttgaccggaagatggaccgctgactaccgtaatcttataatcacgtca
ttcaaggtttcaaaggcgtttatgcacacgcactctgttgaggttcggagtgagctggcc
gctttgctggagtatttaaggatggctcgtgttgtggtggcacagaagggggagacgtct
tcccaagcagagatagataccgcagtcatgtattgcctggccaggctggatgactatggt
gccctcagcgagtttctggagtcagtcaatccacgcgatagtactgtgataccgaatcgc
ggaggaataaaggaggtcggagagaagtgctttgctgaggagcattacaaggctgcaaag
tacttctttgagtttgtcggtgactggtcacgactatctcttacgttggtcaagcttcgc
tgcttgaaagaggcggtggaggctgctacacgcgccgcagatcctgagtgctggaaggcg
gtagctgcagagtgcctggagatccgcgattttgagcttgcaaagtcagtcttcctcaac
ctcgtcctcgtagagtctgagcttccgtcgatagtgcaatattatgaggagtatggtttt
attgaggagctcctcgaggtcctggaggcaggcgccgaacagccgcaagcagccacatac
acctctatggagacgaatatattcaccatcctggcaatactttactgtaagtacatgtgg
attgttcgcaagacagacccccagcgtctacaaacgtatatcaagacgcacggaaacaaa
atccatatcccgactcttctgcactggacccgtgagacaaggctctggggagagtacgcg
tatctgctggcagcgtcccgtgacttcgacaaggctgtcgttgagatgatagcccatccc
ccgtcgtctttcaatcatgatgttatgaagaaggtgataggacgggtctcaaatcctgag
ttggttgcccaagtcgtaagcttctatattgagtactccccagagtatctctgcgacttc
ttaaaggcttgtcagctcggggttccaaatgccgacggctctccagggatccctgctgcc
ttggatcctattcgagtgattgctatggtgagatcctacgattgcgtccctatgattaag
tcgtacctggaattgtttgtaggtgcgcacaaccaggaaattaacgagaccttgataaag
atttaccttgagagctatgacgacgaaggcctgaggagacttattgccgcaacgactgcc
tatgatgcacacgcactcttagacaatttggtatcggaggatcagacagatgacatgcgg
aagcttgcggtagggctctatggacgcctgaatcgatacgacgagggcatcaaatttggt
cttcagaattggttttatgaggacgctgcggagtgtgcagcggactcgggacagatcgag
cactgcgaggcattgctacgcttagtctgcagctcgcagttccccacgccgaagatcaga
aaggaggtctttgctgtcattctcattcgctgcggccactgcatcaggcccgacgtagtc
atggagttggcctgggtcaacagaatgacagactacatgatgccatacatgatctccacg
ttgcaacgctacgggtctgcagtccgcacacttgcggggtcgattgcagaagcaagaggc
atgattccggcgcagcaagcaccccaacaacactag

DBGET integrated database retrieval system