KEGG   Giardia lamblia: GL50803_102890Help
Entry
GL50803_102890    CDS       T01047                                 

Definition
BUB3
Orthology
K14298  
mRNA export factor
Organism
gla  Giardia lamblia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GL50803_102890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 363 aa AA seqDB search
METRRLLSVTPKDGITRVRFAPDKPLLAVSSWDENVYVYNTAEKDPDRTFIASLPLHNKP
IFSVDWVSDATIVSGGADGNVLTTSVGKRATSLVGRHAAPVREVCVLPSNRNIVISGSWD
SHVAAWDIRTAAPIPSTHEIARIGSPPPLSKIAAGGKIFCMDVRGSRVLLGLSSRTVQMW
DCLPTNDLGSSPLFKQVLVRESPLRHQTRSVAIVSDIGNQFCLGSLEGRIAVDNVAGPDR
YAFRCHRHQDPQANVFVSYPINAIKWCGWRNALFTGGSDGDLYLWNLQSRKRLFRLCESS
GIASIDISSQEHDTIALGLSYTWENGWDFSRKNATSALHDTKIVCYSVSEFFPKDDKAQE
GHQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaggcgactactatcagttacgccgaaagatgggatcacgagagtgcgcttt
gcaccagacaagccgcttttggcagttagctcatgggatgaaaatgtatacgtctacaac
acggcggagaaggatcctgaccgcaccttcatcgcaagccttcctctgcacaacaagcca
atattctccgtggactgggttagtgacgcaacgatagtttccggaggtgctgatggcaat
gtcctcactacctctgtcggaaagcgtgctacttcactagtgggaaggcatgcagctcct
gttcgggaggtgtgcgttcttcccagtaatcgtaatattgtgataagtggatcatgggat
agccatgtggctgcttgggatatccggacagcagcacccatcccttcaacgcatgaaatc
gctcgcatcgggtccccgcctccactcagtaaaatagcagctgggggcaagatcttctgc
atggacgtgcgaggttcccgtgtcctgttagggctgtcctctaggactgtacagatgtgg
gactgtctcccaaccaacgaccttggtagtagccctctcttcaaacaggtactagttcga
gagtctcccctgagacaccaaacacgctcagtagccatcgtttccgatatcggtaatcag
ttttgccttggcagcctcgagggacggattgctgttgacaacgttgcaggacccgatcgc
tatgctttccgctgtcacagacatcaagacccgcaagccaatgtcttcgtctcgtaccca
attaatgcgatcaaatggtgcggatggcgaaacgctctattcactgggggatccgatgga
gacctgtatctttggaatttgcaaagccgcaagcgcttgtttcgactctgtgagagttcg
ggaattgcgtcgatagacataagctcccaggaacacgacacgatagcgctgggactatcc
tacacatgggagaatggatgggatttttcgcggaaaaacgccacgtctgcgctccacgat
acaaaaatagtatgctatagtgtcagcgagttctttcccaaggatgataaggcccaagag
ggccatcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system