KEGG   Giardia lamblia: GL50803_103713Help
Entry
GL50803_103713    CDS       T01047                                 

Definition
Protein disulfide isomerase PDI4
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
gla  Giardia lamblia
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:gla04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MIPPIFALLLAVSVAEVLVLTQDNFDSELEKHKNLFVKFYAPWCGHCKKLAPTWEEMSNE
YTTMPVAEVDCTAHSSICGKYGVNGYPTIKLLQSSGAVFKYEKAREKDEMMKWADSMLEP
TLTKCDSVEDCAEKSRKVRALNYFLLEAPEYKEIYESYFTDFKGEHFFGFLKAKEWKLTA
VREGEHIVYKGTENSNVNYIKKFVASHRYAFLPLLGQDNAAALIHERGRPTVIFALDTER
DNKLLKTLSKFAREIILNPKDETSFIEMRYTLTFSDTGSWKQFFEGIDVDSSAGPKIVIY
DNASPKKQVFQADFGEDPVGSIIEFLKKHKTRQLTGVPLGKDGRVVRPDGDKEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgattccccccatcttcgctcttctcctcgcagtgtctgtcgcggaggtgctcgttctc
acgcaggacaacttcgatagtgagctcgagaagcacaagaacctctttgtaaagttctac
gctccgtggtgcggacactgcaagaagctggctcccacctgggaggagatgtccaacgaa
tacacgacaatgcctgtggccgaagttgactgcacagcccacagtagcatttgcgggaag
tacggtgttaacggctacccgaccatcaagctcctgcagagcagcggcgctgtctttaag
tatgaaaaggcacgcgagaaggacgagatgatgaagtgggccgactccatgctcgagcca
actcttacaaagtgtgacagtgttgaagattgcgctgagaagtctcggaaggtccgtgct
ctcaattacttcctgctcgaagcccctgagtataaggagatctacgagtcgtacttcaca
gatttcaagggtgaacacttctttggtttcctcaaggcaaaagaatggaagctgactgct
gttcgcgaaggagaacacatcgtctacaaggggacggagaacagtaacgtcaattatatc
aagaagttcgttgcctcgcatcggtacgcctttcttcccttactgggacaggacaatgca
gcggccttgatccacgagcgtggcaggccaactgtaatctttgcactagatacggagcgg
gacaacaagctcctcaagaccctttccaagtttgcgagagagattatcctcaacccgaag
gacgagacttccttcatcgaaatgcgttatacgcttacattctcggatactgggtcgtgg
aagcagttcttcgagggtatcgacgtggactcctctgctggccctaagattgtcatctat
gataacgccagccctaagaagcaggtcttccaggcagactttggagaggacccggtgggc
tctatcatcgagttcctcaagaagcacaagacgcggcagctcacaggcgtcccgctcggg
aaggacggccgggtggttcgccccgatggggacaaggagctctga

DBGET integrated database retrieval system