KEGG   Giardia lamblia: GL50803_103713Help
Entry
GL50803_103713    CDS       T01047                                 

Definition
Protein disulfide isomerase PDI4
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
gla  Giardia lamblia
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GL50803_103713
Enzymes [BR:gla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GL50803_103713
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GL50803_103713
  Exosomal proteins of colorectal cancer cells
   GL50803_103713
  Exosomal proteins of bladder cancer cells
   GL50803_103713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 354 aa AA seqDB search
MIPPIFALLLAVSVAEVLVLTQDNFDSELEKHKNLFVKFYAPWCGHCKKLAPTWEEMSNE
YTTMPVAEVDCTAHSSICGKYGVNGYPTIKLLQSSGAVFKYEKAREKDEMMKWADSMLEP
TLTKCDSVEDCAEKSRKVRALNYFLLEAPEYKEIYESYFTDFKGEHFFGFLKAKEWKLTA
VREGEHIVYKGTENSNVNYIKKFVASHRYAFLPLLGQDNAAALIHERGRPTVIFALDTER
DNKLLKTLSKFAREIILNPKDETSFIEMRYTLTFSDTGSWKQFFEGIDVDSSAGPKIVIY
DNASPKKQVFQADFGEDPVGSIIEFLKKHKTRQLTGVPLGKDGRVVRPDGDKEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgattccccccatcttcgctcttctcctcgcagtgtctgtcgcggaggtgctcgttctc
acgcaggacaacttcgatagtgagctcgagaagcacaagaacctctttgtaaagttctac
gctccgtggtgcggacactgcaagaagctggctcccacctgggaggagatgtccaacgaa
tacacgacaatgcctgtggccgaagttgactgcacagcccacagtagcatttgcgggaag
tacggtgttaacggctacccgaccatcaagctcctgcagagcagcggcgctgtctttaag
tatgaaaaggcacgcgagaaggacgagatgatgaagtgggccgactccatgctcgagcca
actcttacaaagtgtgacagtgttgaagattgcgctgagaagtctcggaaggtccgtgct
ctcaattacttcctgctcgaagcccctgagtataaggagatctacgagtcgtacttcaca
gatttcaagggtgaacacttctttggtttcctcaaggcaaaagaatggaagctgactgct
gttcgcgaaggagaacacatcgtctacaaggggacggagaacagtaacgtcaattatatc
aagaagttcgttgcctcgcatcggtacgcctttcttcccttactgggacaggacaatgca
gcggccttgatccacgagcgtggcaggccaactgtaatctttgcactagatacggagcgg
gacaacaagctcctcaagaccctttccaagtttgcgagagagattatcctcaacccgaag
gacgagacttccttcatcgaaatgcgttatacgcttacattctcggatactgggtcgtgg
aagcagttcttcgagggtatcgacgtggactcctctgctggccctaagattgtcatctat
gataacgccagccctaagaagcaggtcttccaggcagactttggagaggacccggtgggc
tctatcatcgagttcctcaagaagcacaagacgcggcagctcacaggcgtcccgctcggg
aaggacggccgggtggttcgccccgatggggacaaggagctctga

DBGET integrated database retrieval system