KEGG   Giardia lamblia: GL50803_104031Help
Entry
GL50803_104031    CDS       T01047                                 

Definition
Glycogen synthase, putative (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
gla  Giardia lamblia
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:gla00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GL50803_104031
Enzymes [BR:gla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GL50803_104031
Glycosyltransferases [BR:gla01003]
 Polysaccharide
  Storage polysaccharide
   GL50803_104031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 753 aa AA seqDB search
MEEEQMYDVEGGPGPGDVICMEFCYEVIHKVGGIETVVRTKAPAMVNEYGDNYFMVGPHL
SWDDKFATNFEEAERNEESEILYKLIDSFEARYGIKGVKYGRWLTAGNPQVFLLPMIYNS
GTHFEHKIDHARNILRTACNLEIPNPGFGEREPYIWNAFLFGVVGWCFVSHAMSFLFTDV
NVIMHSHEWIGCVAQVLYSRNGNCETGQRENHLHFLFTTHATTLGRHLSAGNICLMDCLQ
VLKEKSADQCASHWDMEASRRKIAVEHRIERAAAHTADVFTTVSEITGREAECFLGKTPD
VITYNGMDVDSARSVGSDIGASHSYYHGKILDFCRGHFYGTTFNPEKTIIIFSAGRLEYK
NKGYDMFLDALHSLNERFFRDPLLEDYKDITVVGIIIAPSQVSQYQVDTLKGISLMQEIK
DCTRLLANKISTNLVDLLTNTALSQNLASLTLGDILSKNDIVLMKRCQQSYASRNNLPSI
MTHTLRDPSLQDATEPILVRMRELGLVNQKESRVKVVWIPEFVSKTSPVGLDYNEFTLGG
SLGVFCSLYEPWGYTSPECCCAGTPSIVSNLCGFGSFIESMVSRDTFKNRSKSVIEQSER
LHHVASLTSISNLNSKRYPHSGSVSDYGASPRDSDTPSSPSGTTTPELRSKAVSNRILHQ
KSIEYIISEHDKNSWNMSKFGVQVVDRVYIDYHESVDRLANMLVDFVRLSPIERTNLRHK
TERASVLCDWSAMISRYNEAHKLAITRRRKHFN
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagcagatgtacgacgtagagggcggaccaggtcccggggacgtcatttgc
atggagttttgctacgaagtcatccacaaggtggggggtatcgagacggtcgtccgcaca
aaggcccccgcgatggtgaatgaatatggggacaactacttcatggtcgggcctcacctt
tcttgggatgataagtttgcaaccaactttgaagaggcagaacgaaatgaggaatcggag
atcctctacaagcttattgacagctttgaggcacgctacggaatcaagggggtcaaatac
ggccggtggctcaccgccggcaatccccaagtatttctccttccgatgatctacaattca
ggaacacatttcgaacataagattgatcatgcgcgaaacatccttaggactgcttgcaat
ctggagattccgaaccctgggttcggagagcgagagccatacatctggaacgcatttctc
tttggtgtcgtgggctggtgctttgtctcgcatgccatgagctttctgtttactgatgtc
aatgtgattatgcactcccacgagtggattggttgtgttgcgcaagtcctctattctcgc
aatggtaattgtgaaacagggcagcgcgagaaccacctccacttcctttttactacacac
gcgacaacgcttgggcgacacctttctgcaggcaatatctgccttatggactgtctccag
gtactaaaggaaaagagcgcagaccagtgtgcaagtcactgggacatggaggccagcaga
cgcaagatcgccgtcgagcaccgtatcgaacgagctgcagcgcacacggcggatgtgttt
acgacggtctcagaaatcacgggcagagaagccgagtgtttccttgggaagactccagat
gtgatcacctataacggaatggacgttgactctgcaaggtctgtgggaagcgacatcggt
gcaagtcatagctactaccacggaaagattcttgacttttgtagaggacacttctacggc
acgacctttaatccggaaaagactatcattatcttctccgcagggcgcctcgagtacaag
aacaagggctatgatatgttcctcgatgcgctgcactcattgaacgagaggttcttcaga
gatcccctcctcgaggattacaaggatatcacagtggtcggtatcatcatcgccccttcc
caagtttcccagtaccaagttgacactctcaaggggatatccttgatgcaagagatcaag
gactgcacccgactgttggcaaataagatctccacaaatttggttgacctgctcaccaac
acggctctttcacaaaatcttgcttcgcttactctaggcgacattctcagtaaaaatgac
atcgtcctgatgaagcgctgtcaacaatcttatgcttcacgaaataaccttccatccata
atgacgcatactctgcgcgacccatcgctccaggacgcaaccgagcccattcttgtgcgc
atgcgggaacttgggctggttaatcagaaggaatcacgtgttaaggttgtctggatacca
gagtttgtgtctaagacaagtcccgttggactggattacaacgagttcacattgggcggg
tccctgggtgtattctgttctctgtatgagccgtggggctatacaagtccagagtgctgc
tgtgcaggcacgccaagcatagtttcaaacctctgtggcttcggaagcttcatagagtcc
atggtgtcccgggataccttcaagaacaggtccaagagtgtgattgagcaatccgagcgt
cttcatcacgtagcttctctcacatcaatctccaacctgaactcaaagagataccctcac
tctggaagtgtttctgattatggggcttcgccacgagactcagatactccttcgtctcct
tccgggacaacaacgcccgagcttcgttctaaggctgtaagcaacagaattctgcatcag
aaatcaatagagtatattatcagcgagcatgacaagaatagttggaatatgtcgaagttc
ggtgtccaagtggttgaccgcgtgtacatagactatcatgagagcgtagatcgcttggca
aacatgctcgtagacttcgtgcgtctttctcctatagaacgcactaaccttaggcacaag
acagagagagcctcagttctatgtgactggtcagcaatgataagtcgctacaatgaggct
cataagcttgccataacacgacggagaaagcatttcaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system