KEGG   Giardia lamblia: GL50803_10666Help
Entry
GL50803_10666     CDS       T01047                                 

Definition
Histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GL50803_10666
Transcription machinery [BR:gla03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     GL50803_10666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 408 aa AA seqDB search
MSDGASSPQKRRDLYFKVVSLNLYDPTIDPHDPKLLLHLLMAKELFCTALPRMPRDYITR
LVFNTSHETACLLQYPHDPGTSPLVAAICYRTFPDVRIAEIAFCAVSITRQYSGLGHCIM
NYLKENIKKRGYTDIVTYADNAALEYFYKQGFSKNITMPEAIWYGRVKHYDQAIFVQCPL
YRNIDYTKVMQRLRRQRELTLKRIGVAPSAFPEALKGKGYVSVEDLVKNVTSFRQVVELI
KKDPQEVYQTIEESISTREEIQRCNSAALYAVVVEAGKAYALPFLEPPPATEWAPNIVHN
DLQIMIDKCRSFFYRTRGIFAEHAKSLWQRCLTFNGDASDRTKLAYELYQGLLASFDWGY
KQYVEETSHDDLGYCYPELQAQNDTSVCAAAMEEACPDVEQAFADLGF
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacggtgcttcctccccacagaagcggagggacttgtattttaaagtagtgagc
cttaacctctatgaccccacgatagacccgcacgaccccaagctgctcctgcacctcctc
atggccaaggagctcttctgcactgctctgccgcgtatgcctcgggactacataaccaga
ctcgtcttcaacactagccacgaaacggcatgccttctacagtatccccacgaccccggc
acgtcaccactggtcgctgccatatgctacaggacgtttccagacgtgcgcatcgcagaa
atagccttctgtgcggtttcgatcacgcggcagtactccggcctcgggcactgcattatg
aattacctcaaggagaatataaagaagcgtgggtacacggacattgttacctatgcagac
aacgctgctctggagtacttttataaacaaggtttctcaaagaacatcacgatgccggaa
gccatctggtacggtagagttaagcattatgaccaagcaatcttcgtgcaatgccctctt
tatagaaacattgattatactaaggttatgcaacgcctccggcgacagcgagaactgact
ctgaagcggataggtgtggctcctagcgcatttcccgaggcactaaaaggcaagggatac
gtttctgtagaagatctagtaaagaatgtcacttcgttccggcaagttgtagagcttata
aagaaagacccgcaagaggtttatcagaccattgaagaaagcataagcacccgcgaagag
atccagcggtgtaacagcgctgcattgtatgctgttgtcgtcgaggcaggcaaggcatat
gctctcccctttctggagccccctccggcaacagagtgggcgccaaacatagtacacaac
gacctacagatcatgatagacaagtgccgaagtttcttctatagaacacggggcatcttc
gctgagcacgcgaaatccttgtggcaacggtgcttgacctttaatggggatgcttctgat
cgtacaaagcttgcctacgagttgtaccaaggcctgctggcctcgtttgattggggttac
aagcagtatgttgaagagacttcccacgatgacctaggatactgttacccggagctgcag
gcgcagaatgacacctctgtatgcgctgctgccatggaagaggcttgtccggacgtagaa
caggcctttgccgaccttggtttctga

DBGET integrated database retrieval system