KEGG   Giardia lamblia: GL50803_11214Help
Entry
GL50803_11214     CDS       T01047                                 

Definition
Kinase, AGC PKA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GL50803_11214
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   GL50803_11214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MEDIQVEAYPELSYKDLRHIKNIGSGSFGRVTLAQHIDTGKYYAVKAMSKRKIIALRQVA
HINNECSILRVVRSPFIIRQYGTYQDDKNVYIILDFIQGGELFYHLRRYNKFPLQVVKFF
AVEILLALGYLHNLGIAYRDLKLENVLVDNTGHIKLADLGFAKRLVEKNADGDTVSQLTF
SIVGTPEYLAPEIIRSTGHDMSADWWAFGVLIYEMLTGSPPFFDDNPDMTCKKILGGKIT
FASGFDKAAKDLIIRLLNPDKTRRLGASINNGTADIMKHAFFSGVNWSWFEKKVVKAPIV
PKLTDPADTANYEDYLDENGNFEEDEIDYENLGSDAAELGLAEIPGTQEEIDALFVGFK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattcaagtagaagcgtatccagagctatcttacaaggatctcaggcatata
aagaatattggttcgggatccttcggcagggtcactcttgcacagcacattgacacagga
aagtactacgccgtgaaggcaatgtccaagcggaagattattgcccttcggcaggttgct
cacattaacaacgagtgtagtatcttgcgtgtcgtgaggtctccgtttatcattaggcag
tatggaacctatcaggacgacaagaatgtatacatcatcctggacttcatccagggcggc
gagcttttctatcacctacgcagatataacaaatttccactccaagttgttaagttcttt
gccgtcgagatcctcctggcattggggtatttacataatctgggcatcgcctatcgtgat
ctgaagctagagaacgtcctcgttgacaacacaggccatataaagcttgctgatctgggg
tttgctaagcgcctggtcgagaagaatgcagacggggatacggtgtcccaacttactttc
agtatcgtgggcaccccagaatacttggcccccgaaattatccgatcgaccgggcacgat
atgtctgcagattggtgggccttcggcgtcctcatatatgagatgctaacagggtctccg
cccttcttcgatgacaatcctgatatgacctgtaagaagatccttgggggaaagataact
tttgcaagtgggtttgacaaggcagcgaaggacctgattatccgcttactcaaccctgac
aaaacaaggagattgggggcatctataaacaacggcacggcagacattatgaagcacgca
ttcttctcaggggtcaattggtcttggtttgagaaaaaagtcgtgaaggcccccattgtc
cctaagctcacagaccctgccgacaccgccaattatgaagactatctagatgagaatggt
aactttgaagaggacgagatcgactacgagaatctagggagcgatgcggccgagctgggc
ctggcagagatacctgggactcaggaagaaatagacgccctgtttgtgggatttaaatag

DBGET integrated database retrieval system