KEGG   Giardia lamblia: GL50803_121046Help
Entry
GL50803_121046    CDS       T01047                                 

Definition
Histone H2B
Orthology
K11252  
histone H2B
Organism
gla  Giardia lamblia
Brite
Exosome [BR:gla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GL50803_121046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 130 aa AA seqDB search
MSKVETKRLMKKTEAGDKGDAKRKHKRHETYATYIYKVLRSENIRSEADTDLGISNKGME
VMNSLVNDLFERIASEASNLAKISKRNTIGKKDIESAAKLVIPGEIGRLIRDEADKALSK
FTSSKESTKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggtggagacgaagcgcctgatgaagaagacggaggccggggacaagggcgac
gcgaagcgcaagcacaagcgccacgagacgtacgcgacgtacatctacaaggtcctccgc
tcggagaacatccgctccgaggcagacacggacctcgggatctcgaacaagggcatggag
gtgatgaactcgctcgtgaacgacctcttcgagcgcatcgcgtccgaggcgtcgaacctc
gcgaagatcagcaagcggaacacgatcgggaagaaggacatcgagtccgccgcgaagctc
gtcatcccgggcgagatcggccgcctgatccgcgacgaggccgacaaggccctctcgaag
ttcacgtcctcgaaggagtccacgaagaagtaa

DBGET integrated database retrieval system