KEGG   Giardia lamblia: GL50803_14364Help
Entry
GL50803_14364     CDS       T01047                                 

Definition
Kinase, CAMK CAMKL
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
gla  Giardia lamblia
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:gla00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    GL50803_14364
Enzymes [BR:gla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GL50803_14364
Protein kinases [BR:gla01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   GL50803_14364
Mitochondrial biogenesis [BR:gla03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    GL50803_14364
  Mitophagy factors
   Other mitophagy factors
    GL50803_14364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MSDQEIIGDYLLGRQLGTGTFGKVRVATHIPTNCTVAIKILSKSKITQMNMWSKVEREIM
IMKMARHPHIINLYEVIYREDDIYLVMEYAEGGELFSYIVKHKRLDSTTARKFFQQIISA
LSYLHIKVSVTHRDLKPENILLTKNKLIKLSDFGLSNVMSEGEFLKTSCGSPNYASPEVV
AGTLYIGPATDIWSAGCVLYTLLVGRLPFDDHYMPALFRKIKTGEYVIPDYVDSGAADML
RGMMTVDVDKRFTIDIIRAHPWFTVNLPKHLLISFDSDPSDREEELRTTDQGQRIVDMYN
ALNRQSTIDDIKRKFKAGQTDSDTVCYQLIHDHIFDEIIARSFGIIGEPESNPAGANRSI
FDSSSLSALGNVASGGSGDHEEDAMDPSGPVISQNPFAPPEAVAPAKGPLLPSQEHEFSG
LVFNTYVRTLPPTLNPEASLSPNARKVDGAEAVSSNTDDGCYNDQTKVASGGLTLAQFRD
GLNGSLRSEKVDKKSMFYFGVTGCNIAVMPPPDMMCLILETMRELGFKWRIGGLNASKYY
DSNIGRDTVVLKTDTSKKRNNFCVAFKLVNPASAIQNDLIIGLTLYIAIDQSNHANYVVD
LRMITGELNLFLHYAQRIGQAITEHFRAG
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcaggagataataggtgattatctgcttggaagacagcttggaacgggtacc
tttggaaaggtgagggttgcaacacatatcccaacaaactgcactgttgcaatcaagatc
ctttccaagtccaagatcactcaaatgaacatgtggagcaaggtcgagcgggagatcatg
atcatgaagatggctcggcacccgcacatcatcaatctctacgaggttatttaccgcgag
gacgacatctacttggttatggagtacgcagaaggaggcgagcttttttcttatattgtg
aagcacaagcgactagactctactacggcacgcaagtttttccagcagatcatctctgcc
cttagctatcttcacattaaggtctcagtgactcaccgggacttaaagcccgaaaacatt
ttactgactaagaacaagcttatcaaactctctgacttcggcctctccaatgtcatgagc
gagggggagtttctcaagacctcgtgtggcagtcctaactatgcgtctcctgaagtggtc
gctgggaccctatacattggccctgcaacggatatttggagtgctgggtgtgtgctctac
acgcttttggtcggcagactcccgttcgacgaccactatatgcctgcgctattccgaaag
attaaaacaggagaatatgttataccagattatgtggactcgggcgcagcagatatgctt
cgagggatgatgactgtggatgtcgataagcgctttacgatagacattatccgcgcacac
ccgtggtttaccgttaacctcccaaagcacttgctgatcagcttcgatagcgatcccagc
gaccgagaggaggagctccggaccacagatcaggggcagcgcatagtagacatgtacaac
gccctaaatcggcagtccaccattgacgatataaagcgcaaattcaaagcgggccaaaca
gacagtgacaccgtttgttatcagctcattcacgaccacattttcgatgagattattgcg
agaagctttggcattatcggcgaacccgagagcaacccagcaggcgcaaacagatccatc
ttcgactcatcgtccctctctgccctcggtaacgtggcgtctgggggctccggagatcac
gaggaggacgctatggatccttctggtccagtgatatcccaaaatccgtttgctcctcct
gaggcagttgcacctgccaaggggcctcttctaccctcccaggagcatgagttttccggc
ctggtctttaacacatacgttagaaccctgccaccgacgcttaatcccgaggcatctctg
agcccaaacgcccgcaaagttgacggcgctgaagccgtttcttctaataccgatgatggg
tgctataacgatcaaacaaaggtcgccagtggtggtttgaccctcgcccaatttcgcgac
ggtctcaacggttcactaagatctgaaaaggttgacaagaagagcatgttttattttggc
gtcactgggtgcaatatagcagtcatgcctccgccggatatgatgtgtctcatactggag
acgatgcgtgaactgggattcaagtggcgcatagggggcttgaatgcctccaagtactac
gactcaaatatcggacgtgacacagtagtgctgaaaacagatacgtcaaaaaaaaggaac
aacttctgtgtagcatttaagcttgtgaaccctgcgtctgccatacaaaacgacctgata
atagggctgacactttatattgcaatagatcagagtaatcatgccaattatgtcgttgat
ctgcgaatgataaccggagagctgaatctattcctccactatgcacaaaggatcgggcag
gccatcacagagcactttcgggcggggtag

DBGET integrated database retrieval system