KEGG   Giardia lamblia: GL50803_14460Help
Entry
GL50803_14460     CDS       T01047                                 

Definition
Ubiquitin carboxyl-terminal hydrolase 4 (EC:3.1.2.15)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
gla  Giardia lamblia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 819 aa AA seqDB search
MNGSWGSRLTSSGNSLKKKPVSGLVNTGNTCFFNSALQFLNAIRPISYPICLQESIPPNS
ETDEDMYFYNQVIAQFEDVVRRMRKERSVCLGISPQSLFSLMETKYDGIRHGIQGDAHEV
LTLVLDAVIRGTNKNHNKKCNYYDPDGNEDLKDAYEKSRSAKLVGLDSPFEQCIETTEIS
RTVCTHCGYTSIGFQHGIGLSLPLPSAPDSGLVSPASADNKIAYDSSTSLTHIVVYVQDK
CKSIHEFRFYIPTKCLHIDCIHRELEDIYREMIYNSLISFSRKQNLFDDFLITAYSHEFD
LTDLDVIVRTILSYHYRNDEEYIRSAHSQVELSLCSDSGEEENSLQDNVGRVTDAADPTA
KDDMHLSSLTYEPITFGNEEIEKVSRRVSEFSGELGADHLIIITMLHASPCSYDNHKQHK
YLTNISSLSRPTPQLLKVAISLCIDPVNLGDSGSCQSRSSCPDPQQTATPLEFCTSTLAF
SYFNPCDDSQLTKSPALTGINDIVKVGLRLLLFQYDLYLRNTYTDLPRSLLSTLLSSESY
TINPYLEPENSSDPLAKSTIRYILKSSKLELIDSILNDTKGASNTVCFQELFKPAIGLFM
QKCHTQTYKTKQFWSLDDCFKEYAKSSIIEGWRCGKENHQNPSGKNSSTLYKAPPYLIIH
LKRFDQVFDNCGRFYLVKKEDNVCYPHVLDISPYIEDQSDTDPKKYMLTAVICHYGSTNY
GHYFAYILSKETGEWWEANDERVIPVPKVRVITPLAYILLYRRISGDLDNTEREARKKHR
TRTGKVDKEQSRRQDMADIYNECQTYNPPHSPQGYEDNE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagttggggttccagactgacctcgtctggcaactctcttaagaagaagcct
gtttccggccttgtgaatacgggaaacacatgctttttcaattctgctcttcagttcctt
aacgccattagaccgatttcgtatccgatttgcctccaggagagcattcctccaaattct
gagacagacgaggacatgtatttttataaccaggtaattgcgcagtttgaagacgttgtg
cgtcgtatgagaaaagaacggtcggtttgcttgggaattagcccacagagtctcttttca
cttatggagactaagtatgatggtattcgccacggcattcagggggatgcccacgaggtt
ctgaccctggtgctggatgccgtgatcaggggcacaaacaagaaccacaataagaagtgc
aactattatgacccagatggcaacgaggatctcaaagacgcgtatgaaaagtctcgctct
gcgaagcttgttgggcttgattcgccgttcgagcagtgtatagaaacaacagagatatct
cgtactgtgtgcactcattgtggatacaccagtattggatttcaacacgggattggacta
tctctaccactgccgtctgctcccgactcaggtctagtttccccagcttccgctgataac
aaaatagcatatgatagttccacttcactgacacacattgtggtctatgttcaggataaa
tgtaaaagcattcatgaattccgattttacatcccaactaagtgtcttcacattgactgt
attcaccgcgaattggaggacatatatcgcgaaatgatttataacagtcttatttctttc
tctcgaaagcagaaccttttcgatgatttccttataactgcctacagccacgagttcgat
cttactgacctagatgttattgtccgaacaattttaagctatcactaccgtaacgatgaa
gagtacattagatctgcgcactctcaggtcgagctttctctttgctcagactcaggggag
gaggagaacagcttacaagataatgtaggccgcgttactgatgccgctgatcccactgcc
aaggacgacatgcacctctctagtttaacctatgaaccaataacatttgggaatgaggaa
atagagaaggtgtctaggagagtatccgagttttccggtgagttgggggcagatcatcta
attatcataacaatgctgcatgcctccccctgctcctacgataatcacaagcagcacaag
taccttactaacatctcatcattatcacgccctacaccccaacttttaaaggtggccata
tctctatgcatcgaccctgtcaatcttggtgactctggttcttgtcaatcccgtagtagc
tgtcccgatccacaacagactgctacgcccttagagttctgcaccagtaccttagcgttc
tcctacttcaatccctgtgatgattcccagttaacaaagagccctgcactgactggtata
aatgacatagtcaaggttgggctcagactactgctgttccagtacgacctatacctcaga
aacacatacactgacctcccacgttctttgcttagcactttactttcttctgaaagctat
accatcaatccatacctcgagcctgagaactccagtgatcctttggcgaagagcacaatt
agatacattctaaagagtagtaagctagagcttatagacagcatattaaatgataccaaa
ggagctagcaataccgtgtgttttcaagagctatttaagccagccataggccttttcatg
cagaaatgccacacacagacttataagacgaagcagttttggtccttagatgattgcttt
aaagagtatgcgaagtcaagcattattgaaggctggaggtgcggcaaagagaaccatcaa
aacccgagtggaaagaatagtagcacgctctacaaggcgcctccctatcttatcatccat
ttgaagcgcttcgatcaagtttttgataattgcgggaggttctatctcgtcaagaaggag
gataacgtgtgttaccctcatgtcttggacatcagtccatacatagaagatcaatctgac
acggatccgaaaaagtacatgctcacagccgtcatttgtcattatggaagcacaaactac
ggtcattattttgcttatattctttctaaagagaccggagagtggtgggaagccaatgat
gagcgtgttatccctgtgccaaaagtcagagttatcaccccgttggcatatattctcttg
taccgtcgtatcagtggggatctggacaacactgagcgtgaagcacgcaagaagcatcgt
accaggacaggaaaggttgataaggagcagagtcgcagacaggacatggccgacatttac
aacgagtgccagacctacaatccgcctcatagtcctcagggttacgaggacaacgagtag

DBGET integrated database retrieval system