KEGG   Giardia lamblia: GL50803_14460Help
Entry
GL50803_14460     CDS       T01047                                 

Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase 4 (EC:3.1.2.15)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
gla  Giardia lamblia
Brite
Enzymes [BR:gla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GL50803_14460
Peptidases [BR:gla01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GL50803_14460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 819 aa AA seqDB search
MNGSWGSRLTSSGNSLKKKPVSGLVNTGNTCFFNSALQFLNAIRPISYPICLQESIPPNS
ETDEDMYFYNQVIAQFEDVVRRMRKERSVCLGISPQSLFSLMETKYDGIRHGIQGDAHEV
LTLVLDAVIRGTNKNHNKKCNYYDPDGNEDLKDAYEKSRSAKLVGLDSPFEQCIETTEIS
RTVCTHCGYTSIGFQHGIGLSLPLPSAPDSGLVSPASADNKIAYDSSTSLTHIVVYVQDK
CKSIHEFRFYIPTKCLHIDCIHRELEDIYREMIYNSLISFSRKQNLFDDFLITAYSHEFD
LTDLDVIVRTILSYHYRNDEEYIRSAHSQVELSLCSDSGEEENSLQDNVGRVTDAADPTA
KDDMHLSSLTYEPITFGNEEIEKVSRRVSEFSGELGADHLIIITMLHASPCSYDNHKQHK
YLTNISSLSRPTPQLLKVAISLCIDPVNLGDSGSCQSRSSCPDPQQTATPLEFCTSTLAF
SYFNPCDDSQLTKSPALTGINDIVKVGLRLLLFQYDLYLRNTYTDLPRSLLSTLLSSESY
TINPYLEPENSSDPLAKSTIRYILKSSKLELIDSILNDTKGASNTVCFQELFKPAIGLFM
QKCHTQTYKTKQFWSLDDCFKEYAKSSIIEGWRCGKENHQNPSGKNSSTLYKAPPYLIIH
LKRFDQVFDNCGRFYLVKKEDNVCYPHVLDISPYIEDQSDTDPKKYMLTAVICHYGSTNY
GHYFAYILSKETGEWWEANDERVIPVPKVRVITPLAYILLYRRISGDLDNTEREARKKHR
TRTGKVDKEQSRRQDMADIYNECQTYNPPHSPQGYEDNE
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagttggggttccagactgacctcgtctggcaactctcttaagaagaagcct
gtttccggccttgtgaatacgggaaacacatgctttttcaattctgctcttcagttcctt
aacgccattagaccgatttcgtatccgatttgcctccaggagagcattcctccaaattct
gagacagacgaggacatgtatttttataaccaggtaattgcgcagtttgaagacgttgtg
cgtcgtatgagaaaagaacggtcggtttgcttgggaattagcccacagagtctcttttca
cttatggagactaagtatgatggtattcgccacggcattcagggggatgcccacgaggtt
ctgaccctggtgctggatgccgtgatcaggggcacaaacaagaaccacaataagaagtgc
aactattatgacccagatggcaacgaggatctcaaagacgcgtatgaaaagtctcgctct
gcgaagcttgttgggcttgattcgccgttcgagcagtgtatagaaacaacagagatatct
cgtactgtgtgcactcattgtggatacaccagtattggatttcaacacgggattggacta
tctctaccactgccgtctgctcccgactcaggtctagtttccccagcttccgctgataac
aaaatagcatatgatagttccacttcactgacacacattgtggtctatgttcaggataaa
tgtaaaagcattcatgaattccgattttacatcccaactaagtgtcttcacattgactgt
attcaccgcgaattggaggacatatatcgcgaaatgatttataacagtcttatttctttc
tctcgaaagcagaaccttttcgatgatttccttataactgcctacagccacgagttcgat
cttactgacctagatgttattgtccgaacaattttaagctatcactaccgtaacgatgaa
gagtacattagatctgcgcactctcaggtcgagctttctctttgctcagactcaggggag
gaggagaacagcttacaagataatgtaggccgcgttactgatgccgctgatcccactgcc
aaggacgacatgcacctctctagtttaacctatgaaccaataacatttgggaatgaggaa
atagagaaggtgtctaggagagtatccgagttttccggtgagttgggggcagatcatcta
attatcataacaatgctgcatgcctccccctgctcctacgataatcacaagcagcacaag
taccttactaacatctcatcattatcacgccctacaccccaacttttaaaggtggccata
tctctatgcatcgaccctgtcaatcttggtgactctggttcttgtcaatcccgtagtagc
tgtcccgatccacaacagactgctacgcccttagagttctgcaccagtaccttagcgttc
tcctacttcaatccctgtgatgattcccagttaacaaagagccctgcactgactggtata
aatgacatagtcaaggttgggctcagactactgctgttccagtacgacctatacctcaga
aacacatacactgacctcccacgttctttgcttagcactttactttcttctgaaagctat
accatcaatccatacctcgagcctgagaactccagtgatcctttggcgaagagcacaatt
agatacattctaaagagtagtaagctagagcttatagacagcatattaaatgataccaaa
ggagctagcaataccgtgtgttttcaagagctatttaagccagccataggccttttcatg
cagaaatgccacacacagacttataagacgaagcagttttggtccttagatgattgcttt
aaagagtatgcgaagtcaagcattattgaaggctggaggtgcggcaaagagaaccatcaa
aacccgagtggaaagaatagtagcacgctctacaaggcgcctccctatcttatcatccat
ttgaagcgcttcgatcaagtttttgataattgcgggaggttctatctcgtcaagaaggag
gataacgtgtgttaccctcatgtcttggacatcagtccatacatagaagatcaatctgac
acggatccgaaaaagtacatgctcacagccgtcatttgtcattatggaagcacaaactac
ggtcattattttgcttatattctttctaaagagaccggagagtggtgggaagccaatgat
gagcgtgttatccctgtgccaaaagtcagagttatcaccccgttggcatatattctcttg
taccgtcgtatcagtggggatctggacaacactgagcgtgaagcacgcaagaagcatcgt
accaggacaggaaaggttgataaggagcagagtcgcagacaggacatggccgacatttac
aacgagtgccagacctacaatccgcctcatagtcctcagggttacgaggacaacgagtag

DBGET integrated database retrieval system