KEGG   Giardia lamblia: GL50803_14568Help
Entry
GL50803_14568     CDS       T01047                                 

Definition
Ser/Thr protein phosphatase PP1-alpha 2 catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gla  Giardia lamblia
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:gla00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    GL50803_14568
Enzymes [BR:gla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GL50803_14568
Protein phosphatases and associated proteins [BR:gla01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     GL50803_14568
Transcription machinery [BR:gla03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     GL50803_14568
Messenger RNA biogenesis [BR:gla03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     GL50803_14568
Spliceosome [BR:gla03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    GL50803_14568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MPLNVDSILYRLLSVRGMKPGSQVDLPEHEIEELVNKAFEIFISHPVLLELEAPIKICGD
IHGQFYDLLRLFEYGGFPPATNYIFLGDYVDRGKQSLECIILLLCYKIKYPENFFMLRGN
HECSSINRIYGFYQECKTRYSINLWKTFKRCFDALPIAAVIDDKIFCTHGGLSPELSSLN
AIQKIVRPTEVPDSGLLCDLLWSDPEPGITGWHENDRGVSFTFGHDIVMKFLKKHDFDLI
CRAHQVVQDGYEFFAKRRLVTIFSAPNYCDEYDNAGAMMSVDDTLMCSFQILKAMNKDSY
NSLGYSGYNQNRPGSPQKSSGRANY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatgtggattcaattctttaccgtttgttatcagtgcggggaatgaagccc
ggctcgcaagttgacctgccagagcacgaaattgaagagctggtgaacaaggcgtttgag
atattcatttctcaccccgttcttctagagcttgaggctccaatcaagatctgcggtgac
atacatggccaattttacgatctcctccgcctttttgaatacggagggtttccccctgcc
acaaattacattttcctcggagattatgtagatcgtgggaagcagagcttggagtgcatt
attcttcttctgtgctataagatcaaatatccagagaacttcttcatgcttcgtgggaac
cacgagtgctcgtccatcaacaggatatacggcttttaccaagagtgcaaaacgagatac
tctattaatttatggaagacattcaagcgctgctttgatgcgctgccgatcgcggctgtc
atagatgataaaatattctgcacccatgggggcctgagcccggagctttcgtctctcaac
gccattcaaaagatagtacgtcccacagaagtccctgactcgggtctcctctgtgacctt
ctgtggtccgaccctgagccggggataactggatggcatgaaaatgacagaggtgtgtcg
tttacatttgggcacgatattgtgatgaagttcctcaagaagcatgactttgatctcatc
tgtcgcgcacaccaggtcgtccaagatgggtatgaattctttgccaaacgtagactagtt
actatcttttcggctccgaactattgcgatgaatacgataatgccggtgccatgatgagc
gtggatgacacacttatgtgctcgttccagatactcaaggcaatgaacaaagatagctat
aactccttaggctatagtggatacaatcagaaccgtcctggatcgccgcaaaagagcagt
ggaagagcaaattactga

DBGET integrated database retrieval system