KEGG   Giardia lamblia: GL50803_14568Help
Entry
GL50803_14568     CDS       T01047                                 

Definition
Ser/Thr protein phosphatase PP1-alpha 2 catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gla  Giardia lamblia
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:gla03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MPLNVDSILYRLLSVRGMKPGSQVDLPEHEIEELVNKAFEIFISHPVLLELEAPIKICGD
IHGQFYDLLRLFEYGGFPPATNYIFLGDYVDRGKQSLECIILLLCYKIKYPENFFMLRGN
HECSSINRIYGFYQECKTRYSINLWKTFKRCFDALPIAAVIDDKIFCTHGGLSPELSSLN
AIQKIVRPTEVPDSGLLCDLLWSDPEPGITGWHENDRGVSFTFGHDIVMKFLKKHDFDLI
CRAHQVVQDGYEFFAKRRLVTIFSAPNYCDEYDNAGAMMSVDDTLMCSFQILKAMNKDSY
NSLGYSGYNQNRPGSPQKSSGRANY
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaatgtggattcaattctttaccgtttgttatcagtgcggggaatgaagccc
ggctcgcaagttgacctgccagagcacgaaattgaagagctggtgaacaaggcgtttgag
atattcatttctcaccccgttcttctagagcttgaggctccaatcaagatctgcggtgac
atacatggccaattttacgatctcctccgcctttttgaatacggagggtttccccctgcc
acaaattacattttcctcggagattatgtagatcgtgggaagcagagcttggagtgcatt
attcttcttctgtgctataagatcaaatatccagagaacttcttcatgcttcgtgggaac
cacgagtgctcgtccatcaacaggatatacggcttttaccaagagtgcaaaacgagatac
tctattaatttatggaagacattcaagcgctgctttgatgcgctgccgatcgcggctgtc
atagatgataaaatattctgcacccatgggggcctgagcccggagctttcgtctctcaac
gccattcaaaagatagtacgtcccacagaagtccctgactcgggtctcctctgtgacctt
ctgtggtccgaccctgagccggggataactggatggcatgaaaatgacagaggtgtgtcg
tttacatttgggcacgatattgtgatgaagttcctcaagaagcatgactttgatctcatc
tgtcgcgcacaccaggtcgtccaagatgggtatgaattctttgccaaacgtagactagtt
actatcttttcggctccgaactattgcgatgaatacgataatgccggtgccatgatgagc
gtggatgacacacttatgtgctcgttccagatactcaaggcaatgaacaaagatagctat
aactccttaggctatagtggatacaatcagaaccgtcctggatcgccgcaaaagagcagt
ggaagagcaaattactga

DBGET integrated database retrieval system